ELF4t 4 ((%444444xxxxVxV$44W4WHHH Ptd\\F\FQtd/lib/ld-linux.so.2GNUafT>a+bJ(L@<'%K.6^YIX`RSW]c74F:Gd _UCV 0?Oe2#\Q9[M  ! &1 ")-/;A8=5$NEPH*D3,ZB(=H1;`Ye/j=H067gM//vD7IW1po@b*:;:Z:(5/%7q:;R:CeEeW:3 B5.AQ7eL X ],3L:8#q5c:8X< ;b3!b= ^S(@ Ȗ:hyeuO:iedG;DJ: -/i: @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strduplistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii "ii ,ii 6Wdee%e&e2eQeT XXXXX X$X(X ,X 0X 4X 8X X?X@XAXCXDYEYFYG YHYIYJYKYL YM$YN(YO,YP0YR4YS8YUCXFP44$,ut>^HUtɋC d SZN9djLdj= P؃u lPK^pSKYtRKT$ YSQM Rh  eu  <vPYPE 8Wh@뺐USMAҍu1[%]Í'US]E Ch@^‰1t#1t&ʉDAv]ÐUWVS] u Q\Z|S{T‰Ce[^_]Í&UWVS } WU^ 9YtPPWPvtC9Xue1[^_]Íe[^_]É'UWVS } EEPM^ 9Yt!ƐPPPP tC9Xue[^_]ËSCBCE]He[^_]v'UWVS }tM1  SWSCBC9uFv PVGe[^_]ÐUVUUUWVSu M]~)<;}|o{1%A% Š1҈CQA% ŠC1A?Cu [^_]Ê%Nt>1ҊA% ŠC1ACC=C1C=CېUSQ]{t]Ë9| C]RRjPC]Í&USP]C~ t C]PPjP⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& PE.C1]Ít&PPjPC뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU [EPLHP@L[[]Í'UUJLBPABPBLBPBL]Ð[UV1S=[XtC0uCLX=[ue[^]à SЃ ƋCLݍ'[UV1S=[XtC4uCLX=[ue[^]à SЃ ƋCLݍ'[UV1S=[XtC8uCLX=[ue[^]à SЃ ƋCLݍ'[UV1S=[XtC뇍&E ;]%uve[^_]ÍE9sJ'USMEut[][]4t&[]Ð&USSS]jnjhe$)@lvQjkShe]feRPShee]Ív'UU0 vv %&]Í&'USMȊt,eCu.t:t _t-u Au1[]É[]Í'USMȊt*eCu.t _t-uvAu1[]É[] UPfVSTf ]Xf\fSÅtePPj:S|1t@jj jPƊ<*„ Шt7Tff fRffPfSePf[^]PhTfSju Sgt@TfPPShl 뎐&UWVS(uVǃ1txEU SSj/WÅpQQj.VtCERPVjntRPE PWjZtB W؍e[^_]ÍvEjj PVZ{t UtF:tA1à Wht@U 렋UPE PWjuà wt )ȋULE>'US1ۋU t&ABHЃ v[]É'U1ɉWVSEE]߉f@f@E 9vj1C9//:%uف//:u;Kt&UF‰U9wE E}ptthte1[^_]Íe[^_]ËUEEUEEE߄uDʋU1B=wU܈EuE@E}Et_GqЉ ƒ.%uA< vE.…%I}?E@E܋EE뛃}UE)߉H øP;:tfUfBCS_損t&UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEADAFDA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$TEQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st <U jhhY*%Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRHKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCP^N{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVSu]}V0M SE)ȋu)ƍ19r e[^_]RC)XP7WP EPEPE PyC;E wKC ;E vC C$;E vC$CCхu;C(r e[^_]C뮍t&v'U1ɉWVS u]U )Ћ})NjS9s SڍBX9s e[^_])PBXP>VPEEu^C;E vCC ;E vC C$;E vC$CCхu;C(r e[^_]ÉPEPEPE P;닍&'U1ɉWVS ]u} S9r e[^_]PC)XP7WPrEE…%udC9wIC 9vC C$9vC$CCхu;C(r e[^_]C밍&PEPMQWSE D y&UVSEu] PMQF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EEE]WhEP G$PG PGPGPGXPhEPu G9EvEMQShUR;]}3ރtvPD;XPhƑEPt2C;]|͋EEEE Ȇe[^_]G냋EH9tPPuVj C봍vPShёEP(PD;XPhƑEPwEPjjhڑb믐USDYt0tfEčERRPEPX ] PEPEPEPEPeh,P eS]SQ-ZeP]ÐUSDYttfEčEQQPEP Uȍ] PERPEPEPehPPESPeP[ eQ!]ÐUSQY]ttERPE PSt$]ÍUVSuPP@\VPXtKye[^]Ít&'UVSuKxPP`\VPue[^]Ít&'UWVSEE u]=e Ȩr;\`jEPS`j)PR&E8`j);E+ED %8xXEE‰E<E9x(MD ÉD @D }G}1;}&D1һ\fft\3G;}|1;}jEEG;}EMUE\t*f>tE\ME 9D)|ƋD)U cf‰tt dd0gfffttKttU)ʉtt`fwDžh t:hfu.t&ff(vDžh(ftff%pdPP$S ~)P*S$uP1tA$PpPQPЁp %*P2PPPu*PPu*P)R}PphPMbPVE)ʋxR|QRPElUPE\PEPdPlRhjPǃte[^_]ÍUj4RPjDžl1USP]C  Sdj9tHS4StLHyE9Pu@Ht9RRSP2 dj@9C}dj]Í&1djPPSh|j djtNj@뽡dj녍'USStjj]@BjtjC,CDt hjA hj~-S,‰S,C0$C0PPCPhj ؋]͍UWVSu-Ph|j#ÃtC9y(e[^_]á|jt@uÅuډߋS RuR1t Шt@u W9=djt:W4t)~2nG t ;W^ WMdj뺋G$u WG0G0#'UWVS tjxjpjljׁvhjtEEPPj-Phjt"O, ^F t&@u@Ett t&@uE CuPtjSDHtjhjhjC0C0C8@C8C<=` SÅS@0S4҉C0t5K t;Sy SS4EхtEM)Ѕ~щMC$EUR9S,jt@uƅEUe[^_]à SO&'U |jjjjjHjhU%UVSM] 9t=@9w-t@9wotU1[^]Ðt&SA@B9rՃ[^]ÉqK9s十[9^1]‰ËQC@B9rv[^]Ðt&UWVSQMƉʉ]u F<иMbE )&ƉǍB‰U?BU{Z[^_]ÍUMU ytzt RQZYÃz% UWVS} u1ۋJ9v[^_]ó9ruF9G1ۈ9tҋVG@B19rUWVSu] SV-Z1Yx e[^_]Ë>)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh豵\j‹ juȁ?BEU;%PEhP~E 9E%EU Mb)ʉҍ)Ѝ£e[^]É@B@UE;4;)E9FRU ؅t1PhVU)‹E +x:jj#jjEU@BjBjUWVSEj]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERhZPTej[^_]ÉڹQPЉ )ʋMRh^QU‹EHUE%&E.P)RhbhjҳjEEvڹPЉ)ʋMRhfQ芳U‹EHUEfj?ډ)US]S$诮jDxHx4Ћ jȀxu! Jx ʀ8t x]ÍvUWVS 1=j9}-1PPEPTPu ǃXF<9|Սe[^_]ÍUWV1=j19}; tF89B8~A<9|tF8t VV$uF8te1^_]e^_]UjV1S9}1 F<9}"tS8t FSS(j<9|ލe[^]Ð&UWVS EPjjhj躱EEE j19 t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99XuPTPEhP蚬XMQj jh $LEPjjh軰~E@EPPEPCj o j<9cv}19} tUB4ujMPVShДQ٫e1[^_]Í&UEPjjhiRPEhĔP薫'URRuà hЃu h1ɉÐUSjt'B jjjHCjjЋ]áj19Y~jtLJ AJ 1҅t̓ EPx8ڋEC CECj@j뒃 R 믡jP JP 1i&US]CP5XKQ+tjP JP j]HjÍv'UUu&jB j@jjjH]j]x&U jjh jjjÐUWVS }u}t<\tFGuEe)[^_]F1ҡeDPt50MFT~~ӋM )RSPWЫ߃듐xtFGFeF 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡeDPuHxtVVPh 1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjj蟫U PUp Pe1[^]ÐUWVSP贪\`8`dRRj,P`t @`PPj:dPGÅ PPj:CdP&UhPhjR pfDžh PdWj  PPj-SqW@jj jPjj jSÃ@=G=v)f fFVh AC 9cPPhj hƍ@ hRPFfh uf fFVX뎍`t`8[ \P蠩e[^_]PhhjP袩dfDžh<*„ Шt+DžlPPj-Sjj jSPlPdPj]g dP裨tl@l?SSdQh?\ZPʨe1[^_]PdVWhPPdPShPQQdRh5PPdPhl뤐&UVSSM ut~,^t{t(1te[^]û܍v RwUt,RSRPuV]SMQhe[^]ú͍v'UWVS|E18tuYY1ɍe[^_]Ðt$u&5Z1Ƀ5Z=Y1Ƀ=Y t' u, Z Z1uZ1ɃZ_uZ1ɃZ8Ř uZ1ɃߣZΘu YԘu7ZUB8njj jP迤1ɣZu7ZZUB8&jj jPw1ɣZe1uu1Ciu1Cdu1CuR5YUB8jj jP1ɣYSE }PWhȝ11gu1Ciu1Cdu1CuMYGUB8Pjj jP衣1ɣYPE PEPhwu?YuΡ E@P觤tN@"EP$Yt^EPE PEPh<Z_3VAZYPWH^ UQE RRPEPh|j!U zWştL@uuYuaUB8jj jPQ1ɣY?誠^ Q葠_ZPV蘠YER@PE PEPhKUPYUB8tvjj jPǡY=@=j@ } uh@PWVh 1Y@rU EQRPhdZfE RPEPh@=  u4YUB8tjj jP 1ɣY u8 YUB8pjj jP1ɣYu0Y\UB8tR PPY1n$uS=YUB8t% PY뼋PE PEPh؟2] MVSQh1lu1Cou1Cgu1Cu+UB8tB8uzEE RPEPhPo,=YUB8jj jP~Y2hPE PEPh PÅ=UB 8UB8/ fDžxPxP|PU@ Efzu fDžz=Y=YxRjpPhTZ>Y5Y" fDžxP3 xjnPR 똃 Pƅ.E} u@ PWVh=[PE PEPhxQjpPhY訞Y5YUBPE PEPhD맋E RPEPht] MVSQh\\tC tރ~t3 F uۃ EhPE PEPhq,EWWQV Ru UhPh(h^h:Eh^hjjjPV |$M] hSQh:t1} uhWVh:U hDjhjq\jjlmnnllhlhlhlkkkkkkkk@l esUD8<j%} tV蔒;uӋYYU;jYBY1 5nV k[QڒZkPΒX$lP’X4lP趒X= kW詒^0mS蜒YlR菒l ŴnPl@~1jjm/}PE PWhȢ މwjPP;u鋽Go uQMQ:t&PPPR}PE PEPh@g{ uIEXB1U EQRPhpl1iu1Cdu1CjZMA8.jj jP! j '&9t 9 Tu1JE RRjSPEPjP 1҅"UB8E!j TWM jqVNX@Pj̏ }TjXQWRTP贎jTX1PPEj} ujPWVjS 1҅gjPH!1҉HP ui1G +1tu1Ccu1Cpu1CuX1APE PEPhJ1@ 1G}] M7VSQhȣd PPE PEPh3}UM SQRhl MDžDžq>6v UUUU@E:1au1Blu1Blu1Btf1ou1Bdu1Bdu1Bt gE }SPWhDžj1҉1au1Ccu1Clu1CjU JQiucj0SSPEP+Z}U EOQRPhܤS}PE PEPh3M } uQRPWVht Eu ]8WVSh_޿5 ƙΙX֙NjEX1iu1Cfu1Ctܙ8PQ0PEPt|} xjP }D8sDžCCE8ujW}0VPP!ƅ_E FPPj(j ÉpXPI CPW Ct8 P8C Q VC$j[S PDSXD@jK{Qt EPE PEPh;jUQQjE RPEPjjP 1҅MA8xjjj jPf1҉$PPEj=jPE PEPjWN 1҅UZ5MA8j DR{}XjGP訆 DjDP譅 Hjj jGP襅LjL?~-E j?PEPhjǂL?1ҋDD1] MVSQhTGP}w8=jjUB 8t4R1lu1Beu1Bnu1Bu }G8u'E PRPE PEPh|PPjjájUdz XW%M Cq V3 }Cjj jOQ+ C @jPh/Cj\dQ\KDD1j EMS] 0VSQh躽FV HEp0=jjMA 8t4Q1lu1Beu1Bnu1Bu }G8u'E PRPE PEPhPPjj茄ájUhz XWM Cq V΂ }Cjj jOQƂ C @jPhCj`hQ`KDU ] MzW2VSQh]Eu ]8WVSh =UM SQRht MPE PEPhĦPE PEPho Pǀ K C$QRPPC S$; MaDx-AgDe=0C C s} M] P7VSQhn9}D8Dž6UE RPEPh<  jQQMjE RPEPjP 1҅N}G8E@‰1iu1Bfu1Bt%ܙ8j0QSPE PƅE FpFPPjj蝁UÉp_rVۀ[ jC jPL jSXLH1҉cPE PEPh躹F}u ]?WVShĦ蚹&PPhpVUtPE RPEPh;E RPEPhHUu ]:WVSh(* < EX; t/1 UWWQRR| uӡt/1WW}QWRG|BuӋU'D D1E RPE PEPh z}D8tmCDžMPPjAPE PEP(PjP 1҅4}u~j$Z ÉZ1U } uPPWVh_ /uh}D8t5CDž/j$J!JzM E SRPEPhl< }D8c Cjj jR|-- PPE PEPhTgPE PEPhJPPjGPE PEPPjP@ 1҅}ujr Ɖr1jZ!ÉZAu=D DkE@PE PEPh蒵c HPb^f   YYQ|$jytRjhqPt{E=jDžpLJ>dUD8PPPDPRtkj‰!U;dMU EIQRPht}PPu ]PGP?WVSh$踳Dމ(UD8 P{XEjDP/zj P.y  Pz j}A%@A?E@ 8tuh P|x_Vmxt4$awjEYP R@PhVWAy jwtVjhPxjǀEQQjPE RPEPjjP 1҅Pj P@yjB% BJ}PPj5jPE PEPjV 1҅G8=j t0PxXEj@Pw 0j0Pv U4jj jB Pv M8jPAP̨jx<QQh@LP E RPEPhp耰 PPEjPE PEPjjPy 1҅UB8j QwMZjAPv=j PuDž Ep>tW=jGGG};ujQЃ H!Ш Ѓ4H!ƒ4E RPEPhhC} u ]?WPVShUM SQRhUM SQRhTnU} uPWVh®Nt} tÚUPPj=jPE PEPjW 1҅M] 1MVSQhĬ迮jPPL}PPjPE PEPjjP- 1҅G8j P,R{uXEj@PtC,PE PEPh赭AMPPj} AujPWVjS 1҅j Qu=jUG% GB8}w > Ps4$sMAZ8to Prà SqjXZUB8uʚMPy WqVhӚSSsgZ뚃 Prp4$yqjWhVQas jBqtRjhPrjǀ}PPju ] jWVSjQ 1҅xj(t PP(qB BaUPPM =jG_E } uPRPWVhxAމ=jG }PPju ] jPVSjQ 1҅wHjP@P1E@PE PEPh\BPE PEPh%7] MVSQhE P+Xw?9Y}Uu M:WVQh@ً ‰rU}PE PWh艦E} uPWVhPiUM USQRhI u]1ҋGGMUM SQRh} u ]GP?WVShۥg޿Wf_ >hMQ:,WjPR`j1] MVSQh*UB8GRRPPPD}PE PWhp跤C1iu1Gfu1GܙuKDžCu ]PVSh@LPE PEPh|/} u ]P?WVShDž CjPPEjPE PEPjP 1҅6UWWj:rVf} jGPrSPS PS$@ C(vEWWhj0] MVSQjRS 1҅UB8tBjjj jPi1҉MUM SQRh$mPE PEPhĢP}U EQRPh褢0n3v:j MPPjPE PEPjPb 1҅}G8 E HQwo PPhTjiÅ9 j SDžB\Z\APC@MCDC@qCVoh}YWR\hPPj:Wd ƅ@jj jPag1҃feVDPu CC W,SLPSPPST@ CXfffCN<$hEp ǃǃǃǃǃǃǃǃC<ǃDž>1iu1Bdu1B}D8jj jP;f=PR@\t9t ;P苅U?Rt0uafufftff{{Ct'jpdFpdC1҉CfDž(jH`AH`PE PEPh`ECufffujt#fx t=f@f%fZPE PEPhݞif@fPE PEPh踞D}PE PEPhT葞5 }3   F OuXSSEAכ6E|?ޛuljHHYYU;s1;MAPE PEPh莎 u5jPPxu ]hכVShBξj {{V~<P@PD@ H eމUD8 jPt P:U=jU TRUTj PPPTS LYYoUE U QRPhl馽}PPhכh}PE PWhܸz] MVVhehכhЛSQh$ÌOOU EQRPh襌1PE PEPh舌Eu ]8WVShh sjCUPPj} uPWVjS; 1҅MA8PPj j|S }jGPSjjމu2=jG] MVSQh菋 މ=jww%MA8tRRPPP+wPE PEPhp鉻QjPEPR߂ulPPPjPPou.}PE PWhp衊-މu8=j_ _PE PEPhV+މzE\<<. CQQj.PsM SyE jDGPP] MVSQh@訉429 PWWjPAtп] MVSQhpCϹM TRPE PEPhp頹ME TRPEPhx}] 4MVSQhňQUPE PEPhH襈1}E RPEPh腈 PPiqؾPE PEPhpK׸QQMjE RPEPjjPD 1҅}G8t~jjj jPN1҉~PPEh0PE PEPjjP 1҅OUB8t?jjj jPM1҉"PE PEPhy:u ]WVSh\PPEjPE PEPjjPU 1҅E=jWerroh^r nehar 'Pbalance'/Au ]hVSh:谆PjXjSPp/PE PEPhLw+UM SQRhwG}PE PWhdw}E WRPEPhCwϧ} uPWVh&w鲧}UM SQRhw钧ϜjtdMSSjU EQRPjPݕ 1҅D}G8t G8EPE PEPhv U} uPWVhavל|jLUPPju :]WVSjQ4 1҅MA8 PPj ju= }jGPSyE pV<PjXjSPXUM PQRhLuPPj j< UjzWP} WR<PjXjSPߐPE PEPhLu隥G}PE PWht|EPE PEPht\ߜ aj1MPPj}PE PWjV裓 1҅ }G8PPj j; ËEj@PSM AP;PjXjSPǏ} uPWVhLs邤E RPEPhseM] qMVSQhsDUBPE PEPhs#UM SQRhzsUPE PEPhZsujPPEjPE PEPjP1 1҅5jP lMQ:C PR9 t$ t f}PPjPE PEPjjP莑 1҅G8Ejj jXSF8U 2 8^Q 8MZËAP7D$6}58^ËWVhS%: Dž9<A~ۋU EQRPhDr$ 9飳U} uPWVhؼkq1}UM SQRhLqءUM SQRh/q黡 \\oC tރ~ F uӡj W\8j1, <^Q6ËEZ@Pr6D$f5UËBP<^Pr} uPWVhGpӠPPE8WN Q36 jRUPh#h^h7jh^hhjPEjPV |'~E hPEPh:>p1K1DE hPEPh:o% jM} PuPWVhpo}PPjPE PEPjjPi 1҅ПG85QQjPN6ƅRPVj4D^~) U^h^BPE PEPhJo S3 SPVE79  Va2}jj jOQ4Dž94@~E VPEPh4nXPE M UxWXSQRhn x V1鏞u ]WVShԾmtj R]5j?M }APAPE PWhumV41^S4&UWVST DžMDžhDDžQ5Y)PWhQ2 GDžV2‰Љ)=1evF1DB u1tp\#€  Шd [1eDB F1DB uGƒ?%u;G@G@~1nu1Cou1CuFDž18tG8u식 xPtD t4V޹t$~޹tW  jDžP2XP1jMVPSQ  jPJ2je[^_]F&N €\ Ш#r*n&t"^xt8F; FPHY FP0Yt Fe F00 v< vDžR^)BHPRS.)ЃDž뵀z hPEPhh[i jP0j   PPEPh넍t& 5j1Vg0[Qj`/XZjjyuЋTT҉uDžD  Gj/ (t WhG_  @t .G,GHwH9YSjOQV R?Å 9 N QWt:G@@t1 to uu;ЋH9| LJ1SaY WY˻Q)΍6P$]LP$ pM)BSlE9WUBi)ET}U WЃUJ4)…JEɉH4uxt&/;H@E5H4)WpuuEH4tڅtʅt )؅~ډыUɉJ4u` jhpjjS @G@@t jhhj jS E؋E܋EEfffEڋG%1E=cG\VPEPS:$t!~\CVujVS@v sfrj .WBt%1E=bP-,MVPQS^#A G (Q`W RPhXHGLE؋GPE܋GTEGXY G|@PPjjS |wlE_PPGPhQRGPhXtڡjDC;x~xjML}DD{D tDDQQjSuEH4Gpuڅtʅt )؅~ڋMQ4aӅW)ЅKuUB4ыG (PW VPh6L @PPPjjS W<Ev'UWVSEEEEEX\tCvuETEuЋ}D j $ EEX\EU‰E Ct2DB @B DxjF @F$xjEF0FDF8sHF<0^@=t S ;E S ‹EЃ}~4tF t;~y VMuMEFuMETEe1[^_]Í& S=~'Et Sm;E} S\EE@EDU@ RgiVSEQhDe[^_]ÿ UWVSQ]CE9r`s,C@tI9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjht\g%Ð&UMQPQQA ǂt)H4BJP JP ]ÉBBJP JP ]ÍvU1҉WVSu} F4tV@хt_tUFtOCREˆEAUU䋀9tl%tUى1t2YQK$K$V BV Xu ؍e[^_]à VЃCE렋EU@9B놉'UWVS uFVEZ9~ }7PPEPVt$XC$u SJJC0@C09~ |ɍe[^_]ÐUSR] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 ReJUWVS}]EW$VjPjC@P @tC$ C$e[^_]QWVS@RC$ C$e[^_]UWVS\UjTZ 99YJshDžPRQEP@m2W J AJ  |F$FF(0F5|xF Ffh B @B B xjA xjC C$C0CDC8RhhRP9 YShjQ@ jhpjjQ @ G @V^r@BX5IFCX5Xe1[^_]PPj:W`A룃 R 7 R 7 Q6) Q6K,tP JP tp N8p xjI xjCBCP JP \P e1[^_]à h,붃 hà hl h4鍶U1WVS\M 5e A1DF u1MtM1DF A15eA1DF uGLƒ%붐LG~u18u`]ubU:EUǀpB0@<QQPRbe[^_]ASq18uE8EǀUB0ǂǂp@<QQPROE8E8Ejj jRUjEj jPUEjj jPUEEǀp@08@<8VVPR.jj jPuUUWVS ]u ptt e1[^_]ËS,PBzXPj WtPPWSt.u(u$u V8 t)ʅ~ u @뛋C08@8ǃp1F4e[^_]Ðt&fS,ǃpfǃ@@t&C,p4߉p4ǃp1e[^_]UWVS EU@@B0EUZ,J0$E9MAD$EH0EX,CL83E uE1EEpt6CL8v̀C4%1ƉptEC4u'CuCC,C4u u CL8ЉU% = %`=@%` = `@E1ЩptECL8EUJ0vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@}%` = `@}1ptEUZ,CL8E9EQP U%%B4B8BDBDf uC:A/&Sstׅt)~t&Qqtхt)~t&ʅtt )ȅ~ʋMQ4s4t[8҉t хEʉH4EHHt˅t Љ)ȅ~ˋUZ4Ee[^_]è C4 C4Y,A)9s)Q0A,0C9C,rQ C0=K,C)9s)S0C,;Cπ;C,몉)؅' R1~UZ,J0HUQQSRtt{MY,%*/&uWWQVQ:tF;ur~;}s!1FtG;}s 1u]uU)ЋS9uQRESRPuҋKEMu'S B @B UE SUMEt|MC )M9}EPEPWRxCUM]vE U1DUDUEfDf%Ee[^_]à hu룃 RC'UWVS]u} UCM$B91tЋ^0))؉F4N)ȉF [^_]Ðt&B91tꀸЋ^()B)ػ F,9s|1u\)F0낐B91uꀸЋ^ )B)ػ F$9s,1ur)F(gtJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0tB9o 딻덐&UWVSE]UM}$B91uꀸu )K0)ȉC4{)C [^_]B91tꀸu )s()BC,9ʸ1ugu )C0jB91uꀸu )s )BC$9ʸs31u[u )C(UtjB9zu tM t1[^_]øٸҸˀtLB9r붍vK(u ))ȉC,} )C4C0tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$:؋U)CXG9sɊ1Ѐ(C9r몊1ЀtC9r돋MXMEW$PVS]RSWÅl8 EfG f% Љ_ uC9&O4tB C9_1ЀH uC9 ECUX$G)ЃXGG9s WBW9r1ЀuC9r}_ uC9e uKC9P1ЀuWMA PQ: %PO)R MY$ MXMEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ uC9[ =C9B1ЀOOEDX9VUDX G@GDX97UDX G@GDX9r ~C9; C191ЀtUXU9_G V C 9R; 6C9;1ЀtUXU9uR_G Mfyt tE f@ f@f@WEЍPXWM EY$jjSPQEUGà rG 놋M uY$jjSVQEUGà rG C9NC91>&'UWVSLE}EE PE1UMUIDM1ɋ]9EUM@,EyR@ЉUÉE؃XE918bU؋MuD U9UEЍ&޿C9]s]]UZ t@MEȋUM\XDN9r&Ẻ ޿C9]s捶UEЋMU\XDT9r Eȉ޿JC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjSh!U1D\fDf%ƅuMYU r}&U܋U܅M܋QB9uEypу9u΋U]K0fǃ@fǃA<@C@D PPQSxe[^_]ËEEt&ME蠳Wq4^VSh]EEǃZUYPB,@LP軖MA,@4A$puPA$m] C$]EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8t)Ѕ~ e1[^_]á)Ћ MbLJE))ʋM>ʉtQQjS,_ZPNLQ@CF4F8BC$puPC$S C$e1[^_]Ít&UWVSL}GW< DBUԋU 1ۋB]ċ$E؉MEPPwVjh]܃ }M؋ERjh%P] uE[]9GE01ЈUuqv ҉UR!eM̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01ЀtMԋ]M9sNwE Ɖu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjhKQn>E0'PEjhP;uUωPEj hRP tˍ&PEj h\PًUQjhgRԨ3듋u)MSjhpQ訨xUB<"<, Ш^Ev'UVS]u fft>fHtUǃhPPjSaZYPFPPuC$ptu C$%e[^]ÀPC$ٍvPCPPVSxe[^]UWVSEEM EP$ыUf@%ETTXUMEMPfDf%E܅<] f%41GD0EEUjhj SBPk( u>MAw3$4ME]CBtUM܋EM&1e[^_]Ë]C9CuыEًP I,S[0tAC pA$UB 6]UEBlME[ ujjVS] SM] MMQ0‰Q0IfWf% ЉfEfH Eh@ PSh9M $hVSQfUƒ fUUz0ljz0]Kƒ ШvUWVS ]}u_O1tLS$E EX EƋC8ƊEEjhj PGP3& tUEe[^_]Ít&Gw$PUB9BuҋEW H,X0PtAC pA$UB E뙋UBBӋڊEhG PEPh}M $hVWQS0{$ƒ S0U DXMSjjPE QXjPCP>ƃS f‹% ЉOƒ Шu 41UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPW|uыM PSQW&UWVS|EEM EċPdыUf@%TLXMMċQfBf%Etcu}}Uf%481Bj hVWD0E…u,EE}ċMWfDf%Eue[^_]ÐMċ}}u0 E‰U9ruu듋Uӊ<;t<=t<;t C9s<=u9tր;;tэKM9tljMs51SЋ eDA u!;t}G}9us}1DA tߋUBDt&MċuuM)΋Hu9C؋Mu);[u00ًU)ыu9ɉU ]ȋPǞhp cz Gz t}GR8PEPQ$G8CXZPG<PsÅMȅthP JP Su,l z Gz KS:MA1ɋxt |C K@C MAD9u׉EċMt uFu}G$zE@m E} jjPEPWUċuJ}fV f% ЉfEċufH HpـuHp9u׉du B @B Eĉʅɉ}GL;E}Ƌ}PVWRUċ0MIM=z}QVPRۜ:p Tz Gz ˅EȋUẺAA QQSB<PBMAA B @PBPEPEPE P)}uNjU}}fMwpƋwp@ ~  R} Rj h# MhjYS hMăH R" R J QBPEPEPE P8uË}fE؉EGp؉Gp h{ EhjXSUWVSU}ȍt2h ,Z CZ UBR8SVQUB8GXZUPB<PYDžMȅthP JP E1ɋpxt G O@G G^\tgPPGPP苖u'CF@Uċ$? 븃 hD hEjXS>e[^_]à RV hLɋp z Gz υtZEȋUẺAA QQWB<PдUċEH$H$NMȅthp Np h h RZUWVSEEUM Eċp$f@%TLXMMċQfBf%EtiuEE]UMf%؉E1BUjhRDQE7u(EċMuPfDf%Eue[^_]ËUMEdEEE9=eud@dE9ds%d;€, Шu1DG uËU9d-ds ;=tC;]r;]KuM9M9s=1SЋ eDA u);t$,t}EG}9Esu1DA t׋d8$UBDMċud)΋Hu9|r9d׉uad} qB @B EąɉCUBL;E}PdWPQ蚕Mċ8u؋dv)l;,E@EEta djjPEPE P7uMuuĉMM}V0fE@}V0EE ll0Ed)d9ɉ(h]ȋ )r Fr _UuBR8WVQ舔MA8CXZPA<P԰ÅMȅthP JP Cuvlv\tLPPCPP&u-F=lB@-Uċ$? 6ulx1Ʌt C K@C uEd9zEtAE E}u jjPWVZUfEM؃ EA0؉A0u9d׉llU@\UEA tuu9sE8~t @UE9rM9Mtutxu)Ή| u6ut_EPt@ ;|u9u׉uыE@mlB@]Mċu6$?u uuċx $?@luH9u%E dUEU ]MU jjSQRuĉËENufPf% ЉEċUfH fE hMIlp z Gz ˅tEȋUẺAA QQSB<Pk E}M @jjPWQ UM‰uUq0UƉq0uf}UBv }EEUl MċEP$P$ R h R R h4 Eh4jHQFEċMUB$ɉB$Mȅthp Np h' uhj^S\UWVSEEM UZdf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSM }]Q,BPf@ %PBLf@ %PEPAVQhh蕌]Ɖ)) 9~@RPWPWƃƆ FuE Ee[^_]镇'UWVS,MUEI0R,EUMA4]A9A$]sVEPSQY]mEUX4X4J ȋMXtB߉tVVZ,SEJ(ȃXP:]===]uMY$Y$Y]UXMMQAZ@ ة!A$]MCd[1fCETfCf%LXM܉E؅U؍]Ћ]܋Mf%41AD0Ej hVSyt6Uz${PjhS踉Uz$EM؉MԋXfDf%E؅hU1ۋP~.MqyXECPVWEPU9PۋMY;]Epu0uDuFtRREPEPSUrF]t*C$BF <E80U%8=8zMy$ YFS Щ!t'Ex$ @ M|_0Uz$E@(^x]M )?9r EjPEPSGPK‹G xu˅1҈…tEEG=-=/w <^P{<^EE=^]VPRS;|  UO =ZEPQwVR |G]É]O \UEu EUMEGPPV} GLPdEp$pu Pp$u Ur$1e[^_]Ë}G$G${8s8u3?9tf EMjPQSW uׅ%t͋uMǁPPjV@^_P2TEp$u`X;|tU@;vF 9hZCZEp$p$U MYQCJ ȩ!}u _G$1fCDžhTfCf%tXplldpdf%<1Bj hWSD8p`t6Mq$PjhSzUr$ulh^fDf%lP|1L~7UZ|`xM PVSQɮ|G9Lϋ|PtUMq$|ËxHH9uuD?9o EjPEP|PGP‹G xuŅ1҈…t_ UZ@;vF 99JAJEP,p0tF BpBU$r$B r$u|x,U@z;v @9j B@BUtыr0R,F BpBq$$A q$;|1lC t D0u0uEPDtUuVCr t}fff  Mq$uBQAZ@ ة!t-}4E O ȋW0Ѐx_0Ur$:ME 0} G(^]7MuQ,BXJ(B B$B B,B0Bt} U G4G4B1ҋht ‹M ҉Q8uu F8}_}RPE PW%P}vMq$EEXu Mu ]AǁF4WWjS!ZYPFLP5]}GG @^Ps@^E1 pjjVS] Sfupd‹N0^pN0hfW f% ЉffN PPEWPzI} G4 8^PJs8^E jhWS] S輩}dp W0f‹EW0pp$0EU SeDt-CoDokiefD : EVUEЋ_ SO$QPSsUG ЋUEf EE>E>ƅEX@HˋPD)GMW=ZDEGMRPQrGUƒUEMRSVPrE؉E@;v @9 B@BEp$p$:19@<?(@9|,Y$'} 7EUxJ(QR,Rj?PouM FQ<  )r}4uE O ȋW0Ѐx_1 9$h ]E}uWS@EPEjhE }MERjh%P]rU B42B4E 0} 7uSE N QV ЃXPEP}_}PPE PWMQYMG8/I|t!;tM!;}ǨPVPhpX1ZGP1GP1GP1PhPqVEhu PEPV /PEUPB,PE z(XPsMYEMǀSSjQ贩Zu YPFL` B @B uɉ~}_ ~UE z VSXPQnMutt VE W Ћw,XÉGG Å~ E j h)SSPU zǍDzjjPE rXVjPRÅ.uM; ^A f% ЉGdPEUX4SÃE SJ ȃXPGU 29MB4AGq$pu q$ }w$tu}E W _ ЍpXESVPh5E1fCTfCf։ǁiMQf%0ESVPh<uV1DtfDfǁuU;J,jr(E TpX9NM߉|\A$\ A$9 EjPEPSV ~u %6Ít&U 2Euj.VPj l}WWPËQhk VhCP`mÉ$SVQwUNE P8t )3 } @҉7MA1ɋ|t u N8ϋr)ljHBBvM 1EU MxB)ЋY L^v^E \XPQSRjU MB$)Ѓ Y ؃XF B)ЋQ ЋXF UFFBFE8hPR&j* M jhHSSQWƒ W[rT)ƉH,BBnUBRSWu]džVVjSZ} YPGLPQEUBG4Fr$pu r$Mq$u]džVVjSl} ZYPGLP}QEUBG4Gr$pu{ϋr)ljHtABB ht RIrQ MEWSAPjhKE uUM]UB19ڋ$|9s EU19|9"M Y41Y4PE}PEPEP]M}O8_] te} t3MYE]ǀVVjS詡ZYPU BLMERj haP]h'EX~UZsJ11EE)r)rϋr)ljHt'BBZTBr۰D Ejh PEPE PҜE p$%EǀPPhUWVS]} Pe‰Ƌˠ Gte[^_]Ít& P=f1҉Gtۉw$эt&U1UMtzt]Ë tA ]0zXuߋB9F+ʋF(NDVHE9ED;M}%tFAF@@FA<vE=jD819 Z@]K]MzE؅VF 9v~E)ЃXEFP8UBUBBx눍&D>VU؁9FFXF)ЋU܉E9"PPPPjWFPF$P$EUBP=jE d8EPYFTtUJJt돸5 PgFTiExxfS8 }%U!‰Uu U9U}%t!FAF@@FA<vlFAF@ZtNDS8 EPPFTF@FA@F@<v áj9Y@FT܉'USP]S, uY BStwCuS C PSC(S@ C]Ãu؋C(S uPPjK QXZjC PmR]UWVS E]j|Lw,tDt^U DjdEPG_GC$u S C0C0e[^_]Ít& cE7FTuEF,u>% = 60DQQjURF F,FTO(At%A Et EEA%"=uFL@t PP )!_s$u SK0K0UjUUdEe[^_]É%"=SF1ۋ ttÉ^6j9Hۍt&? W>t&__sQTRDPEPSu OOrt[stVt jdjDF0uF,u FT?FL8E$&'UWVS u~(F E^, u,%.PPEjPG u7K,u8STu1%=PPEjPCe[^_]u˩tċFFPPEjPsC1ɋt K_tG 1ɋt O놋FMFPPjQ$WuAG 1ɋttIOFFFF  8밸<U&UPPUB(:u# u%tt/PPjB PËBBQQjB PBBPPjB PƍUWVS u^,> FF jDC,ډJ % = %=C tKC,uCTt%"=V(Bt!B =EttyEEB)^S$u SeC0C0e[^_]ÐCTt#C,u {T4VVPPjF P @뀃> VxNN C1tt lj{F j DF jdF PFFC0u{,u KT>UPP A @A t.xjB @B$xjB0BDB8tFB@tHB4BRjVh}֨l@ ePjjhL&UWVSE#Uu0tfE<uE<uZ{%&Ct U)Ѕ~XuS9uۋE@E}vETEyEuuF4e[^_]áYt:tt2CuPPhhK PhjGCS PSUSRu<E4U_UE PEPF%Ív'US] thP JP KtlH IH pP JP []ÍvUSPv <PqfTuC t SF9djtlC$t- CP(tjSDHtjhjhj tX KX xjI xj]dj눐UWVSUBxHtExtUB`J\Ft&ǁ uE9}}^MMEEtt&A#9tJ uUME䋚)AM9}UB\뮋M[^_]Ãt=1҉ËE;] ШtM ]vMrUP\@d@`@p@lǀtDBt2 u.t*t.Adu Au@AdApu]ËA`@A`Alt&U‹H`t @lJxBt]ËtBxBt]ËBpBtBdBx] UVS]Ss;StMu3SS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉSS빉UWVS}G\LJOLJ`OLJE0%t6Uډ]}Uu6%uʋu_|EEt01ҋFFt[E6ȉEuЋE9E|QSSjMQELJ2}e[^_]e[^_]ËE6ȉE룉EUWVS ]SK{9 P()P(CwdNGpwd9tBtt ut቗l kufSSe[^_]Ë;䍇GGlG`HG` Pnǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPS*e[^_])QQPWjUWVS u^\džUdžQdž Wdž$&CCu߉xFlFp^\dždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPW]t&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFpFd@FFduP؅tt>9ut6.&;aiFlF`@F`O(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AlAp;B= P UZ(B$؋Z )1dEGGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ Pȝ V豝E싗Y[X)ЉVSvUVSuue[^]Í& SAXZV )1SPwe[^]Í'UVS]SKs9tKu4t uu=SSe[^] uu;u܃tBVp)‹FdHVpFd9u8tBtt utቖVl)‹F`HVlF` P+ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFpЉFpFd@FFduT؅ttB9ut:2;v~FlЉFlF`@F`S )1PPPQwCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xpωxpS )1QQURPECCe[^_]Ë9]e[^_]a]e[^_]aE)plΉplY PAsv'UVSu^\dž[dž Zdž0\džYdž Ydž$&CCu߉^\dždždždžt\CtG uCt?tHS )1PPPPue[^]Í붍&U1WVSEUu RtPEPj?Vx4Ã1MC؉])u)ƋEu E3vWuVj&S+4ÅCM؋U)ȉ])‹EU9EU<=uM9މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1qte[^_]Íe1[^_]Q_ v'U1ɉWVS;uuȉ]9_t%!9uNjEȅt M̉E V 9F$s믋]tQ9}t5U^)ȉPPPS萍ME苀Eu?9}tEU苒Uu4WXUSP]K$uSfBhtzBLBPBTBXBtBC@uf$fff&fff1K$]ËB t1BB B$B(1K$ƍvRt0yc$(,0뵁 zmfff&ffE S"K$댃 S"K$UVSuuiF$tj1tW9tOF%t KC,C4S<~ 9S4} V e[^]à VÅtF;l%=t_F$F$F$A$Bt~bterRRSVI1b?ɀlPPPڃ S09C r䋞 FA B^'UWVS }G$u WpXG,XPPjjj(ƃC /9YZ )QhjV&@ jhpjjV% @WBB@B%1E=]G= EPB\PSVl:Å Vn#K PPGVhz_[QGRhjPa `e[^_]ÍvWGJ@!ȩPPVG,@LX S)WBtW%1E=S==@PEP,PSVh9ÅPjSVs&@G, j@PD D jO0Lp:O,DADL \DF;x~xPPjVO,APt4_$@_$P$BP$;P(PWt QЃO,WpYP1ҋ t ‰S1ҍe[^_]ÉP(=Et&RRhePn^4$.!pe[^_]Í& jhhj jV" t& jhpj jV" W!sorfj] btdnq V @wL @PPPjjV " W=E nPSh6eP\]4$ ^XSQGRh$jP]`BlE: VK SSGQhL[GRhjP] yB| @PPjjV! <E hx[4$8P V%0VVhKeS@\tet~it  5xVGShxhPPGPh(ZGVhp xQGRh`Q xPGWh4PPGVhXoZ[QGRh'UWVS ]3wC$tfSBt`C$ SuC,@Pp0u@0@4CAe[^_]ËSC,@PH01@G1҅tC,@PP0 @0@p4t?8 @,8,9B@Bt GCA9V4u$FF,t V9F$ P)Cs,1ɋl~Ptt[FPO@0p4z})ljHt"B,B랋EBݍUMAtt9}]Ë)Ћ]Ðt&UWVS EEt vuuUBh% Bh1e[^_]ø ut)Лuu*UBh% Bh빋UBh% Bh1؃u3UMBhq% Bh>hXUD8jj jPEjj jDPU(M: 1lu1Beu1Bnu1BtMD8~jj jPOgUjj jDP1M@,gM1Ar1Ai1A u&UB8M Ah% AhS=EYPRpUM APxUM A8 UB 8u7U$uǂ$0Mǁ$| PIM$벋MDPhEPE PEEDPh0VhlԋE8dd1gu1Biu1Bdu 1Bt&dddp LQ@[pd:tjd1uu1Biu1Bdu1B jj jpDPZp[d:uv hZ0Y@Ye1[^_]jj jp@P…)Y=h[)h[УY뎍vjj jpDPjjjp|Wr[p tV@PtjPpAPEu\tto[VhxUREPe[^_]QhRh؋pLQh8VhpPh볋p\ShPh8Ph둍&'U E hPEPJÍUWVSEEME蠳U@0Ew $<1ۍe[^_]ËE Mfǁe[^_]ÅZt|u VE2C\\1.u1Bu Mu 9qt-t}9{uƋU K\9ωƋMuf}ttU 9 ]fǃ uufdžE (hh"M PP8Ehhw] PP71҉EhhRP7Eĉhh!WPGqY1^RP71҉EhhvRP71҉EhhRPn71҉hh u RPM7M_ZQUR}W}MQURSPhh^W"H0hhv1RP7hhM 1҉Ƌ RP61҉hh } RP6W t JtQVSPEhh^PG PPEP1ۋ}WCU] u{\fdžuE fdž(}fLJ}}/Utt'9PtU]ljt}u‹E܅u}܋]ES"H9%EE Et EE]E?W}E (tU E PynPjU P1 W5[VZ\ PM ˋ)PPAdPy`WIts|ʋ։ƍTP dP} PPPP PP WVSQM苀PPPPPPWhlh^QD쀍]VVS]S+A1ۃAuhhx1ҋ<RP31҉Ehh8RPo3E,hh"QPl^Z1RPG3Eh(hhw_,SI4EhhG(RP 3Ehh!G$RP2Eh(hhvOU܋)@P]bSh^VBGu(R(uRU B|ӍD1Phh^VA G;}U܃ PBPhh^VtA G@tq9}X9|T)ʍPhh^V}AZYWEPs=EWh2ʼnhhh _,S0$Q RVS(QLRHVDS]苏@Q8RPG(PG$PG8PG4PPM Phh^SZ@GDR)@PEubuSh^P@GPG%PU B|ӍD1PhFh^V? G W P)P PPhCh^V? hhh O RU@Vh]h^R> ]jhLh^S> ,P#gPhdh^S>h h^EuEEvUShhh^R>t&MShkh^Q=;t&M܋]܋PPjW($@RY[PE܋ RPh #PPj)P RPhmh^Vw=UQhqh^R[=XEZP1ۋEP9hh#M PP,Ehhx] PP+1҉EhhRP+1҉Ehh"RP+EhhwPP(e1^_RP+1҉|hhRPk+1҉xhh!RPI+1҉thhvRP'+phhRP+hh u ËRP*YUR}WMQUR|WxQtRpW}SPhph^W;@1hh!RP*1҉lhhvRP^*1҉hh RP@*1҉hh M RP*] ZYdCdPK`QKtS|‰``TÉPdPjM )P;OZYP] PPlPWVu苍dQhh^V:S\4~P} PEhh^PS: qU)ʍuPh&h^V:U R\S\.h^Phh^V9H} E1ۋQh,h^P9XZUREP5] E PaPjU P[PB t HtRM ˋP PP W}英VQRPPPPPh(h^W8P/ jSA$)M0QQR) Tb'UWVSEu} E蠳$X.t&{ t (TfdžÉufdžfdž%e[^_]øuPEhxh^P7UB ~ EQh h^Pv7džhX]ZSGPP EF$puPF$u F$=fdžyUShh^R6XEZPWS31҅fdž)Y YE PljRpjPjjPRPYPYPYRYPuP<EP1҉Rщ1񸉈RQ1ų RE.RYP[PPPUBu8MPh`h^Q5`tBSSuRhEUHQhh^R@QQMh^QRRuRhMAPEhh^PU5UB ~AOSShuREMIQh8h^P 5 PPuRuRUE@Phhh^R4MY EPUE]HQhh^R4hh^S4XZSW01҅fdžfdžA&PEPSVt 1MEQhh^P4XEZPWb01҅ e[^_]èRRhuRMUBPhh^Q%MPhh^Q3Phh Q! YEUWVSEu} E蠳&$pPPEPGPPfdž )fdžfdžfdždžfdžt9-&{ t (uATfdžÉufdž77e[^_]Ít&PjSVu1݋뀍v )Ѩ0 pjYYPljPjPjPPYPYSRPYP<1QRf1󸉈QR1ųU RE.RP[UPYPh8h^Rf1XEPW-1҅]UPPh^RQY[]SW-1҅ t&'USP]pt]PjE PSmtǃp]Í&UWVS\E }(jpt e[^_]Ðt&uEEt&E fLJLJpe[^_]ÍE;Ut BUPB4PC,@PC,Ph@h^V/S,J JPhh^V/S,J8Phh^V/S0JPB4PC0@PC0Ph`h^VK/S0J ePhh^V$/S0J8!Phh^V/SHPK@QSDRC4Phh^V.PCxPC|PClPhh^V.SJ4 :Phh^Vv.CP$Ph h^VT.Y^uVU R*ÉxGC PSh%h^V.C f@% *PCH8Qj)PBBZYPC@0PpPhh^V-S,JQhB)PA S,y@DPh2h^VU-PPhB4 )PAPh)RA XPh)R}A t&QQhB8)PXAQQhB)P8A{QhB)PA S0!QQhB8)P@QQhB)P@Ej4PPj2ff@tRUCPCPQRhGh^V+ E fLJE LJpxEj4PPj ffbPPVU BPP/‹xEfLJ%C US Sf9A&UWVSU (]pte[^_]Í}EhE<Utt2}x9 ttG9 uoEUt;AShh^h]Q)XZhSE PE& UEǀǀCvTUǂT} Eǀpe[^_]Í$t]뺋}t;pt&hUYPxlpl^{ 9t+RVheh^hP(t ;rhYg€\%tbl9h ZCZpG@p? tp;J1ҊOʡeDP@uA<€  Шu€\ Шl9dh\1hȋSB SV U ch hXCX/h_h Bp@BM9WWhVM Q#}xމt;XN\L\El9Zh\hhSZXËDxsh^XDDȋhrD^ZDret]ߋ4nPPWE @PP ǃǃǃ}E|WWP|Pt[^JMb)RMQUREPElPE\PEPhh^hP%t0fz]j.St$Pj nMt G PGPGtPRotRtB WBVJQSM RPhh^hP$@PPhWu V/! ]ǃtGh G@GpÉxHut G PGPGtPRotRtB WBVJQSM RPhЍ] j.SPjzM%fǁǁpvUhbÐUWVS<1] utK4dt:EEEEtUfBfEڐt& jhpjjVT t5EQjPV0x 1҅ttR1ҍe[^_]ÍERjPVɃ jhpjjV 2 E܍UȉEfEj EREh ,fEjEVE @t Ej Ph ,jV| @H@UBE jhpjjVF Y4dt&UWVSE] Mۋu…%tE 1~te[^_]ERjjfF %PÃ9YPhjS@a jhpjjS @C jhpjjSg @F jhpjjS? Fm(P@ PF PS@WWuPS\@١jFDC;x~xjDDD DtjDDUE…%u Ee[^_]PEPEPE PEEE< SqEE\EE놃 Ws@$WjjS @EEE jhpjjS @u jhpjjS @WEEEB jhhj jS` EEEEEMEMvUWVS 1UB@z@`*t&PjjS ƃt`9u֍e[^_]ÍUMyt]É$dA$d(dǁcǁ d@(d] UMyt]ÉcAccǁcǁc@c] UWVS } u FPPW8 t )ʅE‹XTt&uMVBT9tGCt: EPjVRCP5A ƒCxu1҈…t{ t,G4G8G4e[^_]ËFEqF0@@G4@@FBF$pt@u F$1e[^_]ËG8uF@PttG81рPF$븸G8ꐍt&UWVSEEX; !"ME9MUZE8t#E8E1ۋP 1iu1Bf<tܙu'PQE0PEP=ÅCvVVjjMH MXjQXPjʃTAXEe[^_]ËE9ErM(EP:tESjPREC (QeU RPMAPPhEPEPSE ;M%ue[^_]Ít&1BUPh})ω}uVEP뿡 (QhURPMyW1VhEPEPe[^_]PPhS^?tH $@pu2RQh8EP}W] E5MYPuUEBP1Y (QU RPMAPPhtA (SZUYWPM1Vh]SMQ (QU RPM9WqVh븋M (V`UZSMQPBPPh냃 SUSh4o SE8Wh4[U (WM[^I QURPh`+t&UE Ut@,u1]Ë@B |]Ðt&UWVSE tx,u 1[^_]Ëw_ A<€ ШnV?1C 1CE;uNC+11ҊS1҉E1CS1҉E1CS1҉E1CSЋUEÉ/]ƒ}%EUEЋ]B 9EE~x11ҊCS1҉E1CS}B=G_(؋O )ȃX9}9|EU@ |o]C X~1CE Uhc@$c4$Pc8$c1ÐUVSu] 9t"u'tC @C Cu/e[^]ÉBJ I J udž빃 SЃƐt& RЃِt&UWVS uVEUt'F$@8S4FEF,@Tb^0CT@N,tP JP tx Ox ]EHtU싂tH IH Ext:Ex4tGU싚dt C tCP JP utU싂lX K8X Et`H IH UtdP JP Etdx Ox V~9׋u AًBABRxtA BQ J9׋uŋF]BF0p Nۉp t Uz e[^_]ËU싚ht C tCP JP uU싂pH I8H v࿉F$FK$S4I҉K$C,t S9C$ W P#.^0 P. P/CVQQjVpP Q9EZtPy9X`Pm9XdPa9X=WT9U^lSD9UpEe[^_])9'U |xxxjhh7%ÐUVSuF,tTPH@D+ t,FV9t uqF0tfPH@D+ t>FV 9t  tHL[^]@D끍&'UWVS ] uC,K(C@A  up t^)Ћ MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QM&S01uC4CC01^'UWVS u} t F$@F HF uPFFG_0uG0Ge1[^_]ÅFt B 땃࿉F$C$HC$F HF rG0t @FAۉtS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@%S4C,t S9C$s SN$N$G0_4C6C,t S69C$ Q[tCtVGNUWVS } uG,_(EF@unC(^{]FDt uZ tZVFJ@!ȩtEPjUw VBLH QU*S4C(XS4{Wv,dž E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$)Ћ Mb<))ʍe[^_]Ðt&C,@u M7 CSS$SC0 C0 3] ue[^_]CL)Ћ MbC<))ʍ|F ASS$SC,{0uC0 C VWuzf8@,8,]9,A@A0F@CCF$=p{{] ue[^_]jC,@u u F@)ȋ  )ѺMbC<)ʍSS$SC0GrC0C0@{4tB8 @,8,M9 B@Bt @FAtAW4ut0Gt*G,t WY9G$s W SS$SC,)Ћ Mb<))ʍuY)ƉHtHAEA,JMM)Ht!BMB,Y뺋EBލv'UMQ$u#AluABQ$Q$]ÃtwQ$Q$ރt Q$΁Q$ UWVSEp@@0 ^,N0$E FDMD F| VlF N0| ^,CL8 CP8O ;E uU1UEptACL8v̀C4  %1ljptE ! C4u u CL8 uC0t Z gЉU% = $ E%=%`=@%` = `@SP:u"t%=%VlBwf^lt&JFlQQPVVl~u.tϋ@tF%tPPFlPV6 Vlt^,E1ЩptECL8CP8EN0t&E7 uE1؉EEptAALڃ8v΀y4z 0%1ÉptE A4u. u&AL8vA9A,sA, uA0= u;A0t4Z t+j9Y~VFz@ E% = %`=@%` = `@1E1ЩptE^,CL8CP8U9EsY$AP8 @F@t F$AP8^,CP8x N0F4F8FlFpFDFDF|F|f uCAS{}tUt )~}Qytхt )~EʅtUt )ȅ~ʋMQ4{4t[8҉t хuEʉH4NHt˅t Љ)ȅ~ˋMډY4t˅t Љ)ȅ~ˋEX4Ee[^_]èC4C4C4C4C4,j9YVFz@ unb UC9C, "C0=K,C)9s)S0C,: -Y,A)9s)Q0A,C ' Vt`Vlf SS$SC,C0uC0@Fl $QQSVЃVl)Ћ MbFlEG))ʋMʺ V=N0rCP8F@ N0 E@C,e)؅x^lPPSV~l^, P[v^,t PGvTV[N09PPSVWt^,aPPSV ^,PPSVcIt^,7PPSVtЋ^,)E@ APPPN0Y4 @V$pU0V$VXN00*PPQVQ<N0 ALPPN0F$pA4N$@N$V`XN0^,V@qWWSV^,VlB ^lS$$薭FAt B^,C4F0@4F$pu@F$h F$[t ALPPN0Af APPPTV$p V$VJX^,C44@* CPPP^,Ѐ@ CLPP^,F$p7C4N$ N$VX^,!V$0V$F F$@t ࿉F$Z$KZ$QQjV*FtAS4ut0Ct*{,t S裹9C$s Q̻^,& = /F4 ^4SVL$VP$n^,C4F0x4vF$pu F$] F$PF$ F$t CLPP^,C> CPPP,t~l ~4 ZN0^,CPHFIF$tFJHYt)Ћ Mb))ʍډVt[t+F$ u%F@tF,PH@D t V VEP t! P#U9dju djMA$t4 ȃPQ#M=tjOhjQD=tjhjutMX KX xj1I xj F4PFl$^,¯uC t )ȅ}/uC t )ȅkuC8 t )ȅVN0¯uA=t )B/uA=t )A8=)st&t(it)V$V$F$F$6t@<oF$@F$0^tWWCPf@ %PF,@Lf@ %PFSQhhPhj)y~8PPfFx%PfF@%PFPWhh0PhjpN~p:PPfFx%PfF@%PFPPhhPhjPPSV_F$0US E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]Éȋ@fG뱐UUM Ѓ ]ÍUU E 1]UU E 1]USUE у  %t []Ít&'USU E  t []U E]ÍUWVSE]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$E @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEP%Ðt&UdEPdd]ÉUEPQP@ ]ÍUWVS u }PPWCP)t9ue1[^_]Íe[^_]UWVSj(EP褨tu=ddtSu)E_t:QUsREPCPu CU<tCu΋?due1[^_]Íe[^_]à EP謪}r&USRË@tS u CP S ]à P҃C P؍t&UWVS ǍX@09uG __uGHIHe[^_]à P螫GHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjj-EtU؉PJEAJMA AAAWWj(SͦtV@EQQj)P踦RRNjE)ǍGPj蹪ÅPWEPS谩E܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjjA]t) EEj Sh ,jP 1@tЋ] ]81҈ƒUUM Ѓ ]ÍUU E 1]UU E 1]USUE у  %t []Ít&'USU E  t []U E$]ÍUWVS,ExEE9E  $=UM܉}؉EԋUEM܋UEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Em=tj1ۅu4u ft)E f1)Ѕ~M )CM =PESPWY^PES1WU;u%t-|u FU;u%uӍe[^_]ËEH E؃t؋j|tu^؉ڃ $tڋ j| vDd FST T S떐t&UVSYuP j處t\PPSj胕 t5PPSjm$t e[^]à PU PD1F8Ѝe[^]Í&US$]PX QZPC8]U]ÍU j |)A j ǀ B4B8B,B$B(B BBB BBB B`]ÐUSQ̀Ãv ۉZ[]É'U4MʃɋU B]!Í&'UWVSE0E9E(54Uu,U1ۋuǃuɋ9tRd=D@tɃ<@̀Ãvۉ50u]EC]9E`0[^_]Ít&'UV5(SӋu%0,@0 ؉[^]ÐUWVSSE] ƉEC<41uE4 ى Z[^_]Ít&'UWVSPE] ƉEC<41t!E'4t: wUU- PF{EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQ(}9sUډ@C9r18}t MQ|F w$,# p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1,Etq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1Ҹ,L$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿ,L$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$/~1ۊY!#E9t]υt=;1A1ҊQ 9At1t1;%뎉[^_]ÍvUWVS1]1O~PP$L0E PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1;%`FW1C1ҊS ƃ>FC4M!1̓w3$11ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊ<;L$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ <;T$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$1S!1C!̓w$21BR Ѕ~1(jjj1;PÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸$Nju =$t3%9u#VPEPs uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$2EU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0R$}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$41ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCSXcT`MMT~`U(RjjTQtWTVP c`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Qc` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`QBc` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPP aE`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$4EPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71B,%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx},@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSP] u @CRQ V^D;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPW] t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM11,1ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$5E%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEBMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $6jE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$7H@vP@t<)u担87DžRt#,H@%u㋅8) PB<v?t { 5,B1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WeЉƃ؅uDžM ERCP~NF fF(ffVffNfF}BtSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:VeЋU+M Md}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$ :]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB PA;C MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh eU ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PeЉEupEEMP EPRQ9UM$ ABLErLPjURMQEPURCPV u'EMA`Up9Re]Ex`UH EPRQ 91C1ҊS à ;AoEUB`Up9&ReM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQH5[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE ::Dž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžBE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPeЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Usage : %s -f [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon ; implies -q -q quiet mode : don't display messages -c check mode : only check config file and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %d tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %d+%d.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %d+%d.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %d+%d.Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Configuration file is valid : %s Error reading configuration file : %s No polling mechanism available. [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselect%d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF}c\Invalid server name: '%s' Socket path '%s' too long (max %d) bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%d/%s%d %s%lld %c%c %d/%d/%d/%d/%s%u %d/%d task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789:@O_kx  ×͗חߗ@@ splice-requestsplice-responsesplice-autoabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerpersistredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledenabledhealthbind-processevenappsessioncaptureretriesblockunlessredirectlocationheadercaphdrprefixuse_backend(unknown)optionhttplogclear-cookiecodetcploghttpchkssl-hello-chksmtpchkforwardforX-Forwarded-ForexceptEHLOHELO%s %s HELO localhost rewritedefault_backendredispHTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 drop-queryrealmhttp-checkmonitorfailindirectinsertdisable-on-404backlogfullconngracebalanceserverredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttracksourceusesrcclientclientipcliexpreqrepreqdelintefacereqdenynocachepostonlyscopedomainenablehide-versionreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionhdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionParsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : '%s': error detected while parsing condition. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d]: custom id has to be > 1000parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. parsing [%s:%d] : '%s' expects 'code', 'prefix' or 'location' (was '%s'). Maybe you want 'maxconn' instead ?parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' expects [:], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : weight of server %s is not within 1 and 256 (%d). parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots or does not start with a dot. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). Maybe you want 'fullconn' instead ?parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. parsing %s : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. parsing [%s:%d]: negation currently supported only for options. Proxy '%s': loop detected for use_backend: '%s'. parsing %s, %s '%s' : fullconn is mandatory when minconn is set on a server. parsing %s : %s '%s' cannot use both transparent and balance mode. parsing %s : HTTP proxy %s has a cookie but no server list ! parsing %s : '%s' will be ignored for %s '%s' (requires 'option httpchk'). parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing %s : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. parsing %s : no line. Nothing to do ! parsing %s : %s '%s' cannot be in health mode as it has no frontend capability. parsing %s : servers will be ignored for %s '%s'. Errors found in configuration file, aborting. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. parsing %s : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': unable to find required use_backend: '%s'. parsing %s, %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': unable to find required setbe: '%s'. parsing %s, %s '%s', server '%s': unable to use %s/%s fortracing: disable-on-404 option inconsistency. parsing %s, %s '%s', server '%s': unable to find required proxy '%s' for tracking. parsing %s, %s '%s', server '%s': unable to use %s/%s for tracing as it does not have checks enabled. parsing %s, %s '%s', server '%s': unable to find required server '%s' for tracking. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled againCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPHTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownhttp-requestconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Proxy %s stopped. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)timeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! parsing %s : cookie will be ignored for %s '%s' (needs 'mode http'). parsing %s : server regular expressions will be ignored for %s '%s' (needs 'mode http'). parsing %s : client regular expressions will be ignored for %s '%s' (needs 'mode http'). parsing %s : monitor-uri will be ignored for %s '%s' (needs 'mode http'). parsing %s : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. %s.%d.tmp%s.%d.bakshowstaterrorsname too long for UNIX socket. Aborting. Invalid name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket. Aborting. error when trying to preserve previous UNIX socket. Aborting. cannot change UNIX socket ownership. Aborting. socket(): not enough free sockets for UNIX listener. Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener. Aborting. cannot listen to socket for UNIX listener. Aborting. cannot switch final and temporary sockets for UNIX listener. Aborting. cannot bind socket for UNIX listener. Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACEHTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. Iy=p:%^^^^^Z`02V|,,OHTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%d/%d/%d/%s%d %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %d/%d%s HTTP capture : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession:calloc(). Not enough memory process_cli():asession_temp->sessid:calloc(). Not enough Memory process_cli():asession_temp->sessid:calloc(). Found Application Session without matching server. Not enough memory process_cli():asession:calloc(). Not enough memory process_cli():asession->sessid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valpathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/; domain=%sCache-control: privatesrvrepsrvhdrConnection: close: %d.%d.%d.%d HTTP/1.0 clireqclihdr: %s /Content-LengthExpect100-continueappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_postCannot bind to tproxy source address before connect() for server %s/%s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. Cannot bind to source address before connect() for server %s/%s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance url_param' requires an URL parameter name.'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri' and 'url_param' options.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓NOLBno checkDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,OPENFULLSTOPactiveY%d %% - %d,%d,%d,%d,%s,%d,%d,%d,%s/%s,%u,,,,,%s

 text/plaintext/htmlunlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate, Frontend%s%s%s%s%s%s%s%s%s%s%s%s,BACKEND,%d,%d,%d,%d,%d,%d,%lld,%lld,%d,%d,,%d,%d,%u,%u,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%d,,%d,%u, %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %u%u%d%s%svia %s/%s%s,%s,%d,%d,%d,%d,%s,%d,%lld,%lld,,%d,,%d,%d,%u,%u,%d%d%sBackend%s%s%s%s%s%s%s%s%s%s%s%s%s%s %u%u%s %s%d%d%d %d%sDOWN%s,FRONTEND,,,%d,%d,%d,%d,%lld,%lld,%d,%d,%d,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy version 1.3.17, released 2009/03/29

HAProxy%s

Statistics Report for pid %d

> General process information

%s
QueueSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitRateTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits : memmax = %s%s ; ulimit-n = %d
maxsock = %d ; maxconn = %d ; maxpipes = %d
current conns = %d ; current pipes = %d/%d
Running tasks : %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.17 Release_date: 2009/03/29 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: Ju\;ŕpTd`U#req_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentreject (unexpected character '%c')response-onlylayer 7cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparent'%s %s' expects a positive delay in milliseconds, in %s '%s'acl '%s' involves some %s criteria which will be ignored.ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sectionserror detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_end ڛ"Ϛ+049AFOJOTYafkpv'Iњњccccccc!=====!Dumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%lu bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splice           #"""""""d"P"?"1"" "!!!!match failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6d:;<=>?@[\]^_` ~$x$r$l$f$`$Z$T$N$H$B$<$7$0$xdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error wwwww PPPPPtttt                                                      Q Q               h h $===================================+%===3$+,==J%================,===========================% <=$============================+$((5))((4939999#4999999988888888884944259999A5999999999999598BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBF:Q:Q:QJOFF:Q:QF:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:QF:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:QGNE:QF:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:Q:QFGPKMKMMMM MMMMMMMMbKbKbKbKbKbKbKbKbKbKPKMLPKPKMMMMKMMMMMMMMMMMM LM\KHNNNN=NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN4NNN,NNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNN$NXaaXbXbc(cNcqcccbbvvvPb?b_YvaahhnluiuiuiuiuiuiAiAiimmmmmmlllxpxpxpxpxpxpBpBppvvvvvvvvffvc[Z^x_x_x_uYZuYZZ]W`^_`5WAqqqr?rwrp:qTsesvssssBssdtt4uuvlvsGt!!B BBAAAAAAAAAAAAA A AA A A yApAgA\AUAOAFA=A9A2A*A#AAAA@@@@@@ @!@"@#@@@@@ @@$@ @ @ @%@&@@ @'@@}@(r@)f@*`@+X@,V@S@P@M@J@G@D@A@;@-9@6@.@.&@/#@ @@@0 @1@2?3?4?5?6?7?8?9?:?;?<????ZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;94:`zR| (x) (Hl* @@07 }P@` $ 0 4h @ Xp88ooo,4Wn~Βޒ.>N^n~Γޓ.>N^n~Δޔ.>N^n~Εޕ.>N^n~Ζޖ.>N^n~Ηޗ,W ['[[:>BFJNRVZ^bfjpv{ĒɒΒԒؒܒp @\\}`@ڛ000``@`unix_streamnlp:A`@ ^ ^ld//00000P11`220222 2@'P2p/0P262`?4EP4pN40W4`4i4 r4@{4`06`?P4DPP4pMP40VP4_P4hP4 qP4@z@5`6`6P6p60666 6@Xh8z`0{`|` |`*~.vd@`p`tcpv6  p:A @cctcpv4p:A @ d d`dddd,,,,`,@,,++Y+ +***e*@**))))))a)@))((f(@( ('''`'G' '&&&&@&$&&%%e%@%(Ȗ(ȖQed d P<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&d-ic9-$-c$CDD$ c$JcIDK$"c$R cQDS$"d$pDdoDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$DDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$DDD!D(D7$;d$(DD $d$Ddd DD DDDD+D/d@d@d@/$/e$tdd #eDDDDDDD*D1d@d@.e@d@1$19e dlibtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)3p177sG0L k|Kd0. `P v0&@rӭs@yR: r9l`lP7m3HZ^`M/ԧ@}~* 6!jPbkl`}P  ^Y0Kw*  AF033)display_version)display_build_opts)usage)sig_soft_stop *sig_pause0*sig_listenX*sig_dump_state*dump*init,deinit0run_poll_loop'0mainL2global^2prognamep2pid2relative_pid2trash2zero2one2nolinger2stoppingu3cfg_cfgfile3UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)17%a2base64base64tab87 ! enable_listenerF disable_listenerk enable_all_listeners disable_all_listeners unbind_listener unbind_all_listeners6 delete_listenerl protocol_register protocol_unregister protocol_bind_allprotocol_unbind_all7protocol_enable_allmprotocol_disable_allGstats_check_init_uri_auth&stats_set_uristats_set_realmstats_set_refresh>stats_set_flagstats_add_authHstats_add_scope4LX0#ultoa_r.$strlcpy2~$ulltoh_r$limit_r/%str2sun%ishex%invalid_char%invalid_domainchar &str2sa'str2netJ)str2uic)url2sa+encode_string,str2ui~,strl2ui-strl2uic-strl2ic.strl2ircr.strl2llrc.parse_time_err0itoa_str?0hextabk| `init_buffervbuffer_write2buffer_write_chunkbuffer_replace buffer_replace2r buffer_insert_line2 chunk_printf, buffer_dump pool2_bufferd+u%Alert&Warning^&qfprintf&get_log_level&get_log_facilityO'send_logr)tcp_sess_log+log_facilities6+log_levelsX+monthnamez+sess_term_cond+sess_fin_state *"#__task_queue#__task_wakeup#wake_expired_tasks&process_runnable_tasks(init_taska)nb_taskss)run_queue)run_queue_cur)nb_tasks_cur)niced_tasks)pool2_task)last_timerN u_tv_ms_cmp_tv_ms_add>_tv_ms_cmp2_tv_ms_le20_tv_ms_remain _tv_ms_remain2 _tv_ms_elapsed _tv_addp _tv_add_ifset _tv_remain _tv_remain2 _tv_isle _tv_isgtk tv_update_datehuman_time]curr_sec_msocurr_sec_ms_scalednow_msnowdatestart_date fd_deletedisable_pollerinit_pollersIdeinit_pollersulist_pollersfork_poller cur_poller( nbpollersJ pollers\ fdtabt maxfd totalconn actconnr7 " get_pipei kill_pipe put_pipe pool2_pipe pipes_live pipes_used$ pipes_freeR%]#exp_replace:$check_replace_stringp$chain_regex5%pmatch&rc6-warnifnotcap-cfg_parse_global 5cfg_parse_listen[readcfgfile`cfg_register_keywords`cfg_unregister_keywordsacfg_maxpconnacfg_maxconnaacl_seenbsslv3_client_hello_pkt0##srv_downtime>#srv_getinter/ӭF13+process_chk.start_checksm&#srv_dynamic_maxconnk#init_pendconn#pendconn_free#pendconn_get_next_sess$process_srv_queuec%pendconn_add&pool2_pendconn0-5)get_frt_addr~*event_accept :1&proxy_cap_str&proxy_mode_str+findproxy+findserver4,proxy_cfg_ensure_no_http,start_proxies-soft_stop.pause_proxy6.stop_proxyg.maintain_proxies/pause_proxies0listen_proxies 1proxy1next_pxidT1listeners9ln6%uxst_add_listener(uxst_event_accept+unix_sock_parse_requestg.uxst_req_analyser_stats/uxst_process_sessionb,init_proto_httpi-http_header_add_tail-http_header_add_tail2T.http_header_match2.find_hdr_value_end /http_find_header20http_find_header`1error_messageF2perform_http_redirectP3http_return_srv_error3http_sess_log5capture_headers6http_parse_stsline7http_parse_reqline8http_msg_analyzer:stats_check_uri_authw<http_process_tarpit)=http_process_request_body>check_response_for_cacheability?produce_content@apply_filter_to_req_headers@apply_filter_to_req_lineAapply_filters_to_request4Bmanage_server_side_cookies'Dget_srv_from_appsessionEEmanage_client_side_cookiesGapply_filter_to_resp_headersHapply_filter_to_sts_lineIapply_filters_to_responseJdebug_hdrJprocess_responseMhttp_process_request_pool2_capture`pool2_requri8`http_is_ctlP`http_is_seph`http_is_lws`http_is_spht`http_is_crlf`http_is_token`http_is_ver_token7aHTTP_200Nahttp_200_chunk`aHTTP_301raHTTP_302aHTTP_303aHTTP_401_fmtahttp_err_codesahttp_err_chunksbhdr_encode_map$burl_encode_mapLbhttp_methodsbsess_cookiebsess_set_cookie.>&splice,'stream_sock_shutrR'stream_sock_read)stream_sock_shutw)stream_sock_write+stream_sock_data_finish ,stream_sock_chk_rcv<,stream_sock_chk_snd3*$appsession_task_init%appsession_initi&appsession_refreshe'match_str'destroy'appsession_cleanup)pool2_appsess)apools)have_appsession7Z^zIN*recalc_server_map,init_server_map.fwrr_init_server_groups5fwlc_init_server_tree5get_server_ph 6get_server_ph_post/7assign_server>assign_server_addressZ?assign_server_and_queue?connect_server Asrv_redispatch_connect[Bbe_downtimeBbackend_parse_balancewԧ=&#stream_int_check_timeouts#stream_int_report_error#stream_int_return*$stream_int_retnclose3M+print_csv_header+stats_dump_proxy-stats_dump_http-stats_dump_rawv.stats_dump_raw_to_buffer.stats_dump_sess_to_buffer/stats_dump_errors_to_buffer,5*tcpv4_bind_socketR,tcp_bind_listenerH-tcpv4_add_listenero-tcpv6_add_listener-tcp_inspect_request%6C38%sess_change_serverm%session_free&init_session&session_process_counters&sess_update_st_con_tcp'sess_update_st_cer-(sess_establish(sess_update_stream_int*sess_set_term_flags*process_session1default_srv_error2pool2_session2sessions!jAhdr_idx_add`^;)acl_parse_nothing)acl_fetch_nothingM*acl_match_nothing*acl_match_str*acl_match_reg++acl_match_begl+acl_match_end+acl_match_sub,acl_match_dir&-acl_match_dom_-acl_match_int-acl_match_ip-acl_parse_str`.acl_parse_reg.acl_parse_int0acl_parse_dotted_ver2acl_parse_ip2acl_register_keywords3acl_unregister_keywordsN3find_acl_by_name3find_acl_kw4parse_acl_expr5prune_acl5parse_acl~6find_acl_default67prune_acl_cond7parse_acl_cond8acl_exec_cond9cond_find_require:filt_cap3;default_acl_listr}O%#create_pool#pool_gc2#pool_refill_alloc $pool_flush2K$pool_destroy2$dump_poolsIread_freq_ctrAfreq_ctr_remainnext_event_delay.feb_deleteeb_insert_dupc[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)Ycheck_cttproxy_versionAOO__udivdi3F`O__umoddi33d{` R0A@p  "0 #[<7 &tBM 5into 60 >E ?E AE3 Ct Di GPAI8 SV U  0 "-< "-S<##/# ## # # #  ##{##O##/ ##z## ##$`##(##, ##0#$#4.##8##<##@ #">#DX ##{#F#$*#Gb#(:#H#1#L #7/#T+#8/#XK#:#\#<@#` / d#! # U## #$# ##< :  P 3BGQ:F" D E# XF# $ >#  # #  + # # +# ; wg67#8#2>q40Yg r  p# ڰ# }#  ܓ# # 7 !kC!t !v# < !x#h n h#p h#C  - C#ref !h#04w d x# yC# z0# E {0# %|0# r}0# ( ~0# T<0# -0#$ u0#( @ c bc# ss @ OH#s#s# bit#u32"09* >+y#key,#rp H 0wq 1#rq 2# . 3#0  4#4  50#8  6#< N 7/#@  8#Dr  N# # # r[# C#? N# #'8&H . &I0# &J0# B&K/#fd&L# T<&M0#exp&N0# 2&O# 2&P# 2&Q# 2&R#$ib&SJ #(ob&SJ #,  &T0#0 &U/#4J &S T<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 #8 &3 #< 7#@ 7#A b#D J#L  #P ? #T E #X y X-tstru#lenv#  J  3  z 'C# L'C# p '# '#fe'#be'# '# T<'#$ '0#(req'J #,rep'J #0si'!#4 a '# d"'# \'#srv'# '# '# '/!#txn'# * '# W'Z# 'A!# M/'X!# '‚# 'Â# ' # '0#y 9 V ] +n   # ! # k auid^f#gid_P# L`[# buxa  LfdM# . N# O# ;P# Q# KR# +"S# T0# VU# VC# F'W# X# f$Y# Z/#  [0# mb # 'c# TQ um# +n# o# p# ` q# r# s#$ 1t#( 2u#, Jv#0 w#4 x#8 vy#< /zC#@ ,{#H |C#L    8%Cf%A#b%BJ # %?cb%C# B%D/# . %E7#ev%F7# O %G # %H#  9<%] %^/# )=%_#set%`#clr%a# =%b# =%c#rem%d#clo%e# 1%f# 5%g#$ @>%h#( "%i#, C%j#0 u%k#4 %%l#8 0 a ^/# _%# 2`%#a+ V,# *-# R.# {/# ; 0 ) h# &#*8len*90#cr*:0#V*;0#b *Cv*Db# ( *E# *F# X'*G# 0*H# )QQ  g-D   )h)l)ݔ#m_l)ޔ#u)ߔ#u_l)ߔ# v)#v_l)#f)l)#v_l)#c)#c_l)# r)#r_l)#)rq)st)@) )0#sol)#eol)#som)0# col)0#sov)0#eoh)0#cap)#sl)f# 4 )b#8) X0)# )# )P #req)#rsp)#Xuri)# V )# >)# AE)# T<)0# B  0#  0# 0#<TH VI# . J# K# hL# M# Z N# O# h%Q# /R# S#$ S#( +"T0#, 6T0#0 U#4 U#8 V#< WC#@ X#H ;Z#L [#\ ;]#l __#| o`# @b# 6b# c# d# Ne# }f# g# ;g# {!h# r h# h# i# j# Fk#idm# n0#  n0# o0# p0# q0# ur0# Vr0# gs# , t# hu# w0# w0# x0# yq# {0# {0# |0# e|0# }0# ~# x0# 4 0# t# t# #h%DQ # F # # . # # 9# L# I# W##,aclC#0 C#8 rC#@ C#H F;u##Psrv#\  #` #d $#h U# # # S# # 0# Ô# Ĕ# # Ɣ# "ǔ# iȑ# # Rʔ# ˔# *&# # eΔ# C# f$%#id# C# ܔ# ܔ# Cݔ# 0# w0# L0# 0# # # 0# H0# 4 0# +"0#  0# 70# "# -# # - # 0# 0# q# 0# 0# 0# e0# 0# 0# 0# t# t# #cap# # ;# _# o# V#  E"#  E"# J{# s{### #q### #`#\#!#_|&#$|&# #` #] #{ &#:  &# # ##Y&##g#0#n 0#"#"#HHZ ( ( C# |(! #srv("#  D' '# z'|# G '|# '|# '# R'# '#$ ;#'[#(  '[#, ('[#0 't#4 't#< 'px'#sv'ǘ# D'Ȃ# 'Ȃ# T<'0# iid'ʔ# E'ʔ#sid'ʔ# ' 'n# 'iid'Д#px'#buf'0#sid'0# ptr'Ԕ#bol'Ք#!' &' |'΂ '֙ /! #A! 5!X! G!yE!!acl * +C#u ,#1? -C#  .# /0#e!"I? > ?C# @C#pol A# B0#R+ C#E"p7 ;4un5V in6^"Jp2u7"#" ,u [vH#t0wH#t1wH# 5x# Vy# z# z{#$ |#(W# |#len0#pos0# sid0#srv#oe#src#bufE #u#be u#  W0# <C## srv## ? # . ##Xact^"#bck^"#,$actH#bckH# % # # g # 7# # # # B #map## H##, ## %# m4%# 5%# %# %#% %%  є# 0Ҕ# 5Ӕ# 7Ԕ# <Ք# ֔# #ה# ؔ#&*  m&# '# Y(# 63)# T<*# -+'# , (# V-&#%|&  V|&# u# Z#len # !# A"#& & &P "&#4#u&C#@&#be&# !'A(!"C#@#&#E$# %#%&# '#T<(0#)# *#$'  V'# # #' (J  V (# # #'T(+Q +M# +N# +O# | +P# )+;uid+<#gid+=# +># +"+?# +@# +A# +B# *+C# L+D# +E#$ +F#( +G#, '+H#0 J+I#4 s+I#8 +J#< +J#@  +KE"#D  +KE"# 1+Q(# x +R # c+S#$pU$ҘU%)l U&u% *  >U'sig%0*!@aU'sig(X*pU)sig(* |U)sig*pV+*sS(*T?U)sig>(X,5QU,W,V*iQ-Hp-l.tmp-#h/W+-S/+P*cur4P-$ 5V-5S0+X,1k,2x,1,1,1,0+X,|1k,2x,|1,1,1,0',X,1k,2x,1,1,1,2X,ʢТ1k,2x,ʢТ1,1,1,3x,n4m3, -4+4?+4=,(/ `ƩU*pW*p0P*h|&S-@|&V*sV- p*lP-S-@&S- &V*expS-P*acl!S-b!V-/S- /V*rdr /S- /V*uap&V*ua&l- 'S*iS/.p5jh/.5jh/4.5jh/J.5jh/`.5jh0./!W1"/2,/!W1=/2G/(W1X/2b/(46o/P0./W{6/Q2/1/2/1/2b/ɨ1o/&'7,/"8t7G/8t7b/8t9{/]:n\{/9/8tǂ7/w ~8t}7/u v8tu;0, \ЩU)sig[V*p]S<'0< j|U-Vkt=1$dU,, *errV-S- %`-'1\/0*w|h/0*pxXS*retYP-s ZV/0(*retP+H-P1>$"1>"1>"1>$LL1R1 >B$ML1>>>  >U %o>%t18>%u> %v> +Z 1? >,Q1@h%->-C>-D>~.;0Anow.<|>.>|> %BqT(YBleCpidmBn[>/+[BE BtConepB2h ;B> /#> 0$>q1#> 2>Q0>QR0>U0>j V> W{/B[keDeDeD!e 3 D63[Q p` R0A@p <7BintAIn#p# N}#}#h#rE# #<) #&N# H H< .0pU ptr}Q h0S 'hU%S&&NP i(hQ@49U3V 3HS idx50P ~<~@U;RN;}W idx=0PW>HSgu\C%C% JUIp IHW idxK0PWLHSв\R%R%jS[ UZW i\0VW]HShjg ` |UinQ:VoutSejintI @A r vv #1` A@p "%<7&^Binto6%>:?:A:3CtDSAI % - -S< s#/ # # #  #{ #O #/ #z #  #$` #( #, #0 #4. s#8 s#< #@  "3#DX #e#F $#Gb (#H 1#L 7#T+ 8#XK :s#\ <#` d ! U #  # s#    3-n-#p-# B G Q$3#  _# #   _# z# #  w    b  #  m  O # # # bit s#u32"%9* >+##key,m#p H0wq1x#rq2x# . 3s#0 4s#4 5%#8 62#< N 7#@ 8s#D,,,'8H . I%# J%# BK#fdLs# T<M%#expN%# 2O# 2P# 2Q# 2R#$ibSg#(obSg#,  T%#0 U#48g S T<}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0  %#4 s#8 &#< ,#@ ,#A L#D J#L  #P #T #X~~g m ] auid^I#gid_3# L`># buxaLfdMs# . Ns# Os# ;P# Q # KRs# +"Ss# T%# VU # V# F'W # X2# f$Y # Z#  [%# mb# 'c# TQ um # +ns# os# ps# ` q_# rT# ss#$ 1t #( 2u #, Jv/ #0 w/ #4 x/ #8 vy/ #< /z#@ ,{s#H |#L ss s  / s  V  Cf A #b Bg#  ?cb C # B D# . E,#ev F,# O G #  HT# 5 j 9< ]  ^# )= _ #set ` #clr a # = b # = c #rem d #clo e # 1 f # 5 g #$ @> h #( " i #, C j #0 u k#4 % ls#8 s s s      s   s     F ]U Sk /3U. S >s@}U = P? S LsU K PM S 'ZsUY S6 js ]U i Pk Sl x`Uw Q !j|-  öU  P жU  R"ֶ!j-As3U  S#errsV7s@U  S#errsVmsӷU  S#errsVms#U  S#errsV$$ $ $U o $ tV $ us % $QS[F0p` R0Aint@p <7BAI V#>#}#J V#># }#* %m&># '}#Y(}#63)># T<*>#-+#,#V-# 0U  V uS 7{ 4 2  D%%%}Pи D*%*}P@{U ? uri?}S uASB}V mC> Sq Qe4\ܹU [  ^[} u]S^}V lӹ jǹ>uU t  t>P uvR7U   >P uRB@1U   } uW}V "> >-SUBp d J  кߺ \% % @U   }V uW[}VSpout  ٻp \% %T02 7` R"0Ag B@p "0<7&tB2BM5into60>P?PAP3CtDiAI8SV U 02Iq40Y1 <x pR#i "7 $P B G Q:F" $D$E#X$F#f 7  J G#  z= J$$I_# +#_# o +###  w+#G# ]## B d r s#O t # u# v#  w #6+n  +#!#  k  -L - S<# / #  #  # # {# O# / # z# #$ `#( #, #0 #4 .#8 #< #@ "I#D X #{#F $#G b(#H 1#L 7/#T +8/#X K:#\ <#`/d! U## #Y  R  3 b#  E  O# # # bit#u32"0y9*>+#key,E#n#p#y - y#ref!#Hp H0wq1P#rq2P#. 3#04#450#86^#<N 7/#@8#DXXXH4#wd #xL##yy##z0# E #{0# %#|0#r#}0#( #~0#T<#0# -#0#$u##(  '8H. I0# J0#BK/#fdL# T<M0#expN0#2O#2P#2Q# 2R#$ibS< #(obS< #, T0#0U/#4 < ST<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8&% #< B#@B#Ab#DJ#L #P1 #T7 #Xk X-tstru#lenv#| | <  %  zy#Ly#p X##fe#be# # T<#$0#(req< #,rep< #0si' #4a o#d"o#\#srv## # 7 #txn##* #Wb#I #M/` # #Í##0#k + H ] { auid^#gid_#L`# buxaH  LfdM#. N#O#;Po#  Q#KR#+"S#T0#VU#Vy#F'W#X^#f$Y#Z/# [0#mb{ #'c# TQum#+n#o#p#` q+# r # s#$1t#(2u#,Jv#0w#4x#8vy#</zy#@,{#H|y#L     CfA#bB< #P ?cbCP#BD/#. EB#evFB#O Gd#H # ` p7;46un5jin6Jp2u7`# N###r[# y#d 8 !a!^/#!_%#2!`%#!a +V ,#* -#R .#{ /# C 8) #&#'8len'90#cr':0#V';0#j 'Cv'Dj#( 'E#'F#X''G#0'H# &   Q Q    g - D   &p &l&ݟ#m_l&ޟ#u&ߟ#u_l&ߟ# v&#v_l&# n&l&#v_l&#c&#c_l&# r&#r_l&#&rq&st&#@& &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap& #sl&n# 4 &b#8&X0&#&# &B #req&#rsp&#Xuri&#V &#>&#AE&#T<&0# B 0# 0#0#<THVI#. J# K#hL# M#Z N#O#h%Q#/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<Wy#@XX#H;Z#L[#\;]#l__#|o`#@b#6b#c# d#Ne#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gsP#, t%#hu#w0#w0# x0# y#{0#{0#|0#e|0#}0#~#x0#4 0#t#t##h%DQ#F ]#]#. # #9#L#I# f!#,acly#0y#8ry#@y#HF;!#Psrv#\ #` #d ,"#hU# ##S##0#ß#ğ##Ɵ#"ǟ#iș# #Rʟ#˟#*̬###eΟ#y#f$-##id#y# ܟ# ܟ#Cݟ#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"]#-]##- #0# 0# #0#0#0#e0#0#0# 0#t#t# #cap##;#_#o#V# # #J{#s{# # # # q# # #  # `# \# !# _## $##  # ` # ] # { ## :  ##  #  # # Y## # g# 0# n 0#  #  #Hb %% y#|%!| #srv%"# D #z#G # ##R#  #$;#[#( [#,([#0t#4t#< px#svǠ#Dȍ# ȍ# T<0# iidʟ#Eʟ#sidʟ#  ͤ# iidП#px#buf0#sid0# ptrԟ#bol՟#' &|Ί֡ 7  +I | = ` | O yE ,u[v#t0w#t1w#5x%#Vy%#z# z{#$|#(f!#len0#pos0# sid0#srv#oe#srco#buf7 #!beu ! W0#<y# ! srv!#? #. # "Xactm #bckm #, ,"act#bck# ###g #7# ###B #map!# H!#, "# '##m4'##5'##'##'##'## # џ#0ҟ#5ӟ#7ԟ# <՟# ֟##ן#؟#*# # # #B !.$<SU"n;[Q# ; #( ;$pos=S!~$,`U"dst+R"src+S#( +Q%-V!$PU"nObVW# O#( O%Q(QS%Rp!/%rؽU"nq[Q# qS#( qR"altqP!%{%FU"strzS$su|je%1}P&'__s/j!%PU"sR!%pӾU#uQ! &!U#uQ!''0(U"strS$sa϶Pf$cP%TџV(׿)&'__s/&,0I'B'__u%''__cӂ*&+'+>',K'+^'+j'+v'-'$__vIP&($he'Px&.K'n/m.' -/+/?+ /=,!8)>0cU"str#;8) #k8)0,0*$cV$sW%S$len[P)r(1__s/2Y(3,03I3'B1__u>)1__c)(1__s/2(3,03I3'B1__uD)1__c))4errd,K'+^'5j'P+v'-!)4he'P&=K1__v0]+((6)^0pU7s,)t5)R89)S9)Q:)\0;sף'i0'j06*K_[U7url^G+8X9S+V&w9`+P&AE1__vI?o+4/;3@dst38)A 5A51ch51tmp6o+1tp6+1cp7BA>BB1newB +x x6,Y`U-:-0;s;len'i0'j0'k06.U7sS7lenQ4iV4jR1k6r.U7sV7lenS7retP4iQ4jR6.u!(U7s 7len  7ret .P4i"tVW4j#lt6/%J0UH#( H#, H#0  H#4 #8 &#< O#@ O#A d#D J#L  #P #T #XtX-tstru#lenv#E t 6] Cf A#b BE#J ?cb CJ# B D# . EO#ev FO# O GZ#  H# Z  U&Ubuf%ESmsg%r len%Vmax'@ 2@  buf E'buf'-  EUbufDES X-DVmaxF / /K kUbjESposj endjWstrjr!lVlenmr UbESpos endVstrrlen!W 9UbESposWstrrlen!V, ,UchkV ( Sfmtr"#=$retP%u M+Uou pbEW YStol&$u &u & t & u 6' & Q &~ ;H(  + ^0` R0A@p "0<7&iBinto60>E?EAE3CtD^~AI8SV U 0BGQ:F u" D E# XF#+iu - / - S<~# / #  #  # # {# O# / # z# #$ `#( #, ~#0 #4 .~#8 ~#< #@ ">#D X #p#F $#G b(#H 1#L 7#T +8#X K:~#\ <#`5  d ~!  U~# # ~#G@3Vtm,w ,x~# y~# oz~# w{~# ;|~# O}~# 3~~# g~# ~~# #$ /#(2>q40Ya l   p# > #   # # #  #  #  ##3w x ڨ# w#  ܍# x#7 b#   O# # # bit~#u32"0 ?9* >+#key, # dnd#pd#?   - ?#ref!d# p H0wq1#rq2# . 3~#0 4~#4 50#8 6$#< N 7#@ 8~#D 4w d x:# y?# z0# E {0# %|0# r}0# ( ~0# T<0# -0#$ u#( '8!H . !I0# !J0# B!K#fd!L~# T<!M0#exp!N0# 2!O# 2!P# 2!Q# 2!R#$ib!S #(ob!S #,  !T0#0 !U#4 !S T<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 ~#8 & #< 7#@ 7#A W#D J#L  #P  #T  #X 1 X-tstru#lenv~#B B  H   z  ?# L ?# p #  #fe #be #  ~# T< ~#$  0#(req  #,rep  #0si !#4 a # d" # \ 3#srv 7#  7# 7# !#txn # * ~# W #  !# M/ !# w#  w#  ה!#  0#1   ] 7 +n   # !7 #G kz auid ^6#gid _ # L `+# bux aG  Lfd M~# . N~#  O~# ; P# Q# K R~# +" S~#  T0# V U#  V?# F' W#  X$# f$ Y#  Z#  [0# m bz # ' c#  T Q u m# + n~#  o~#  p~# ` q# rV#  s~#$ 1 t#( 2 u#, J v#0  w#4  x#8 v y#< / z?#@ , {~#H  |?#L  ~~~~%Cf%A#b%B # O %?cb%CO# B%D# . %E7#ev%F7# O %G_# %HV#_ ~p7;4un5 in63 Jp2u7j#&Q &M~# &N~# &O~# | &P~# 2&;uid&<~#gid&=~# &>~# +"&?~# &@~# &A~# &B~# *&C~# L&D~# &E~#$ &F~#( &G#, '&H#0 J&I~#4 s&I~#8 &J~#< &J~#@  &K#D  &K# 1&Q# x &R # c&S~#   N# # ~# rP# ?#2* a ^# _%# 2`%#a + V,# *-# R.~# {//# %  S ) d# &e#__S $8len$90#cr$:0#V$;0#  $Cv$D# ( $Ew# $Fw# X'$Gw# 0$Hw# k F#!!!Q!Q ! !!g!-!D !  ##l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#Qst# @# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#ڴ#sl## 4 #W#8 X# X0#F# ## # #req##rsp##Xuri## V ## >## AE#~# T<#0#  B  0#  0# 0#7<T H V I7# . J~# K~# h L~#  M~# Z N#  O# h% Q# / R~#  S~#$ S~#( +" T0#, 6 T0#0 U~#4 U~#8  V~#<  W?#@  X#H ; Z3#L  [3#\ ; ]3#l _ _~#| o `# @ b7# 6 b7#  c# d3# N ew# } f~# g~# ; g~# {! h~# r h~#  h~#  i~#  j~# F k~#id m#  n0#  n0# o0# p0#  q0# u r0# V r0# g s# , t# h u7#  w0# w0# x0# yA#  {0#  {0#  |0# e |0#  }0#  ~X# x 0# 4 0#  i#  i#  ~#h%D Q  # F #  # . ~#  ~# 9 ~# L ~# I 3#  "#,acl ?#0  ?#8 r ?#@  ?#H F; ##Psrv 7#\  ~#` ~#d ##h U # #  ~# S #  ~#  0#  ~#  ~#  #  ~# " ~# i *# # R ~#  ~# * C%#  # e ~#  ?# f$ $#id #  ?# ~# ~# C ~#  0# w 0# L 0#  0# X#  X#  0# H 0# 4 0# +" 0#  0# 7 0# " # - #  # - ~# 0# 0# A#  0#  0#  0# e 0#  0#  0# 0#  i#  i#  ~#cap ~#  3# ; 3# _ ~# o # V #  #  # J p# s p#  ~#  ~# ~# q ~#  ~#  ~#  # ` # \ ~# ! ~# _ O%# $ O%#  # ` # ] # { U%# : U%#  ~#  #  ~# Y e%#  ~# g ~#  0# n 0#  "#  "#H=  " " ?# |"!B #srv""7#  D ~# z L# G L#  L#  # R # #$ ;# P#(  P#, ( P#0  i#4  i#<!! px ƶ#sv 7# D w#  w# T< 0# iid ~# E ~#sid ~#8!  j#! iid ~#px Ѷ#buf 0#sid 0# ptr ~#bol ~#! & ˪ | !! 8!!!B !!B !yE " , u [ v#t0 w#t1 w# 5 x# V y#  z~# z {~#$  |~#("   L#len 0#pos 0# sid 0#srv 7#oe #src #buf ## be u @# W 0# < ?#s# srv s## ? ~# . ~#7#X act "#bck "#,# act #bck #$  ~#  ~# g ~# 7 ~#  ~#  ~#  ~# B 7#map @## H y##, ## $# m4 $# 5 $#  $#  $#$7$=%  ~# 0 ~# 5 ~# 7 ~# < ~# ~# # ~#  ~#*=% I%e% u% "%A0U#fmt@/$%B&tmCH'%D[(%D(%P)%*now%*tm% A"^&_V/U#fmtU/$%W&tmXH'%(%D(%P"&j0dU#outi&S#fmti/ $%k+&y~pU#levx/V,z~S-%\}%%}%+O'~U#fac/V,~S-%\%%%"#)U#pV.~ .1/S$,~\,~\,\%,#)`f,g`j,~~,4 ~P,^~,$4),,,~W,~,WS/(,JJ)P, ~R,S0(Sl1JJ)V11~P'U) 2f)-N&tm'%Sf(%(%P4)D)D)P) 3r)~4JJ)5Q*B?^U6s>B S7pn@7feAW7beB~1C~1D~V1lE~7tmF~8 *%(%~(%P0:*9__vi>-9__vj>:$&:&:&:%t*:%u~: &Z~*;:Q*:'=L:&V:&WE?EAE3CtD^AI8SV U 0BGQ:Fp" !D!E#X!F#    b#  p  Ox### bit#u32"0'9*>+#key,#LnL#pL#'{ - '#ref!L#4 wd x# y'# z0# E {0# % |0#r }0#( ~0#T< 0# - 0#$u #( * 02>q40Y5 @| pV#$># ##  ###  wWڇ#K# a#W# g7  -r -S< #/ # # #  #{ #O #/ #z #  #$` #( #, C#0 I#4. #8 #< #@  ">#DX #p#F $O#Gb (_#H 1#L 7#T+ 8#XK :#\ <e#`d C! U C# I# # r _  u 3p H0wq1#rq2#. 3#04#450#86#<N 7#@8#Du'8 H. I0# J0#B K#fd L# T< M0#exp N0#2 O#2 P#2 Q# 2 R#$ib S; #(ob S; #, T0#0 U#4 ;  ST< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& $ #< 7#@ 7#A W#DJ #L #P 0 #T 6 #Xj X- tstr u#len v#{ { ;  $   z '#L '#p # #fe "#be "#  # T< #$ 0#(req ; #,rep ; #0si *#4a #d" #\ #srv # # # :#txn &#* #W e# L#M/ c# ‚# Â# # 0#j * G ]p +n  #!p # k auid^1#gid_#L`&# buxa  LfdM#. N#O#;P#  Q #KR#+"S#T0#VU #V'#F'W #X#f$Y #Z# [0#mb #'c# TQum #+n#o#p#` q# r|# s#$1t #(2u #,Jv#0w#4x#8vy#</z'#@,{#H|'#L       ) Cf A #b B; # ?cb C#B D#. E7#ev F7#O G# H|#   N###rP# '#{5 a^#_%#2`%#a+V,#*-#R.#{/*# @5) L#&#$8len$90#cr$:0#V$;0#g $Cv$Dg#( $E#$F#X'$G#0$H# #QQ  g-D   #m#l#݉#m_l#މ#u#߉#u_l#߉# v##v_l##k#l##v_l##c##c_l## r##r_l###rq#st# @# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap# #sl#k# 4 #W#8#X0#### #A #req##rsp##Xuri##V ##>##AE##T<#0# B 0# 0#0#<THVI#. J# K#hL# M#Z N#O#h%Q"#/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<W'#@X#H;Z#L[#\;]#l__#|o`#@b#6b#c# d#Ne#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, t(#hu#w0#w0# x0# y<#{0#{0#|0#e|0#}0#~#x0#4 0#i#i##"h%DQ #F a#a#. # #9#L#I#  #,acl'#0'#8r'#@'#HF; #Psrv#\ #` #d p!#hU# ##S##0#É#ĉ##Ɖ#"lj#iȖ# #Rʉ#ˉ#*"##eΉ#'#f$q"#id#'# ܉# ܉#C݉#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"a#-a##- #0# 0# <#0#0#0#e0#0#0# 0#i#i# #cap##;#_#o#V"# # #Jp#sp### #q### #`#\#!#_"#$"# #` #] #{ ##:  ## # ##Y###g#0#n 0#, #, #Hxe "" '#|"!{ #srv""# D  #z G#G G#  G# #R #  #$;# P#( P#,( P#0 i#4 i#< px "#sv ǣ#D Ȃ#  Ȃ# T< 0# iid ʉ#E ʉ#sid ʉ#  R# iid Љ#px "#buf 0#sid 0# ptr ԉ#bol Չ#* &  | ΍ ֤ :  .L{ @c{ RyEp7 ;4un5G in6Jp2u7p#, ,u[vx#t0wx#t1wx#5x(#Vy(#z# z{#$|#( G#len0#pos0# sid0#srv#oe"#src#buf6 # be" u W0#<'# ! srv !#? #. #K!Xact#bck#,p!actx#bckx#_"##g #7# ###B #map # H&!#, K!# k"#m4k"#5k"#k"#k"#k"_"" щ#0҉#5Ӊ#7ԉ# <Չ# ։##׉#؉#*" " # "#A !m#T`U"p SS#m#s$~###s|$#%#u v&tu'#](n\#)#0U*t/S+,5P!M%yU"Vx V,p zW-eb{#S.<$M%$^%/h%P.$s%$%#%$%#%/%P$%.$%$%#%$&01&R#% /%P$%.$m#$~###$#.%&&,@$7&/B&P.4%N&@f$[&#g&r$x&$&%s%n_&t1^&t2^%% 7#( 6(2%6%3 5(2%%3Q(3OB0%%QC#(nB#2&&fT%3>S%4tU%N&yk(j&nowj'g&(p %&h&tg&fg0!',RU"V -tS-eb#V,C0W,p.7'%J$%#%J$&0J1&P#%8G/%P$%.c''JP$'##JP/#P.z'N&$[&.''$($ (#s%-$%#%-$%#%-/%P$%%'&t%(&t1&t25(`U6(fz7__st( ,0 > '77__u(7__cw+7__s( ,0 > '77__u(7__cwJ((8$(g8(8 t))8 u :)9 8%Q))8~&;0:now&#H 1#L 7#T +8#X K:h#\ <D#` d"! U"#(# h#Q >  T 3"'8H. I%# J%#BK# fdLh# T<M%# expN%#2O4#2P4#2Q4# 2R4#$ ibS#( obS#, T%#0U#4..T" ST< }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4 h#8& #< ,#@ ,#A A#DJ .#L .#P #T #X:  ]hhC fA# bB#_ ? cbC_#BD#. E,# evF,#O Go#H# o  -hKUtv1,Qtv2,Shtv1tv28p8PUtv8SY mshQ6hUtv15Qtv25Rhtv1tv2AhpUtv1@Vtv2@W)#0*htv1)tv2)K:pUtv1JVtv2JS| ![:tv1Ztv2Z J:tv1Itv2I"retK: U:,Utv1TWtv2TSX '#'!  a:0jUtv1`Stv2`R;W ($P: i8pUtvh8VYhRinchP: ~L W c p w8tvv8%Yvincv OrhUtvq8SYqVincqQ     Nhtv8%Yincd {8dUtv1zRtv2zPtvz8Vd )v    8tv1tv2tv8- B8pUtv1Stv2Rtv8Q - }? K W d v   c t c A8tv1tv2tv8 {o8tvn8 h Utv1Qtv2R    htv1tv2C ^h PUtv1Qtv2RC )7T _ k ]htv1tv2&MPUghSh '7j'p'h((: rL W c M^i9M^iuuhtv1tv2x8tvx8,&UthSaQ)rvj)p͓p)cnthl  *$ F* *t,*uh P+ * Q?,%,%,~%-now,, /+0` R0A@p <7&^Bint3CtDSAI 0 -a -S<s#/ # #  #  #{#O#/ #z# #$`#(#, #0#4.s#8s#<z#@ ">#DX #e#F$#Gb(#H1#L 7#T+8#XK:s#\<#`g d!  U# # s#s  l  3  >#   # # + '8H . I0# J0# BK#fdLs# T<M0#expN0# 2O # 2P # 2Q # 2R #$ibSZ#(obSZ#,  T0#0 U#4+Z S T<}0#rex~s#wexs#rtos# wtos#ctos#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 s#8 &}#< 7#@ 7#A L#D J#L  #P #T #XqqZw ` ]ssCfA#bBZ#6 ?cbC6# BD# . E7#evF7# O GF# H# F +9<] ^# )=_E#set`E#clraE# =bE# =cE#remdW#cloeW# 1ft# 5g#$ @>h#( "i#, Cj#0 uka#4 %ls#8@s@s s+W@KnnsL]snznJ%0Ufd$sS11Uo0ap2sV\5%5%IV>s`Up?sQbp@nVuTW`UbpYnpZsV{isUouthpjsS X'ksh VksW a4lspbpmnl!csU"$"#U L#@sj J L #[:  #n j#sx# s# s $ " Q 3 t.r` A@p  "%<7Binto 6% >: ?: A:hAI % BGQz $  n $# p $# 4w d x# y# z%# E {%# %|%# r}%# ( ~%# T<%# -%#$ u#(  23q 4%Y    p#3 T#   # T#d   # o# #w   # #  # #, )+n   # !)#9k ap7 ;4+un5in6 zJp2 u79# b#z O### bith#u32"% 19* >+# key,# p H0 wq1# rq2# . 3h#0 4h#4 5%#8 6#< N 7#@ 8h#D1 a uid ^# gid _# L `#  bux a  L fd Mh# . Nh#  Oh# ; Pd# Q# K Rh# +" Sh#  T%# V U#  V# F' W#  X# f$ Y$#  Z#  [%# m b# ' c#  T Q u m*# + nh#  oh#  ph# ` q # r#  sh#$ 1 t#( 2 u#, J vJ#0  wJ#4  xJ#8 v yJ#< / z#@ , {h#H  |#Lhhh:Jh:Q Mh# Nh# Oh# | Ph# ; uidh# +"?h# @h# Ah# Bh# *Ch# LDh# Eh#$ Fh#( G#, 'H#0 JIh#4 sIh#8 Jh#< Jh#@  Ka#D  Ka# 1QP# x R# cSh#    h# J!h#  "h# V# # i & Uret' (p@__p5S IUpH S V8UpU R d@rU Fp!"V# j*# j#hj#hj%13 ` R0A@p "0<7&iBM5into60>E?EAE3CtD^AI8SV U 0BGQ:Fp"  D E#X F#|  a^#_%#2`%#aAe jh#ii#Rj?+V,?#*-E#R.#{/v# K 2>q40YP [ pq#$># ##  ### - wrڢ#f# |#r# 7  -  - S<# / #  #  # # {# O# / # z# #$ `#( #, d#0 j#4 .#8 #< #@ ">#D X #p#F $p#G b(#H 1#L 7#T +8#X K:#\ <#`dd! Ud#j# #-  &  3 b#    O# # # bit#u32"0M9*>+#key,#r n r#p r#M - M#ref !r#p H0wq1$#rq2$#. 3#04#450#862#<N 7#@8#D,,,4wd x #yM#z0# E {0# %|0#r}0#( ~0#T<0# -0#$u#(  '8 H. I0# J0#B K#fd L# T< M0#exp N0#2 O#2 P#2 Q# 2 R#$ib S #(ob S #, T0#0 U#4  ST< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& #< 7#@ 7#A W#DJ #L #P  #T #X? X- tstr u#len v#P P  V    z M#L M#p ,# #fe #be #  # T< #$ 0#(req  #,rep  #0si #4a #d" #\ -#srv # # # #txn #* #W # #M/ # w# w# |# 0#?   ]E +n  #!E # U k auid^1#gid_#L`&# buxaU  LfdM#. N#O#;P#  Q#KR#+"S#T0#VU#VM#F'W#X2#f$Yp#Z# [0#mb #'c# TQum#+n#o#p#` q# r# s#$1t#(2u#,Jv#0w#4x#8vy#</zM#@,{#H|M#L      Cf A#b B #W ?cb CW#B D#. E7#ev F7#O Gg# H# g p7;4un5 in6-Jp2u7m# N###rP# M#8;) r#&M#GG;#8len#90#cr#:0#V#;0# #Cv#D#( #Ew##Fw#X'#Gw#0#Hw# S."   Q Q    g - D   " "l"݉#m_l"މ#u"߉#u_l"߉# v"#v_l"# "l"#v_l"#c"#c_l"# r"#r_l"#"rq"9st"@" "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ڜ#sl"# 4 "W#8@"X0".#"# " #req"#rsp"#Xuri"#V "#>"#AE"#T<"0#w B 0# 0#0#<THVI#. J# K#hL# M#Z N#O#h%Q#/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<WM#@X,#H;Z-#L[-#\;]-#l__#|o`#@b#6b#c# d-#New#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs$#, t#hu#w0#w0# x0# y<#{0#{0#|0#e|0#}0#~@#x0#4 0#i#i##wh%DQ#F |#|#. # #9#L#I-#  #,aclM#0M#8rM#@M#HF;!#Psrv#\ #` #d !#hU# ##S##0#É#ĉ##Ɖ#"lj#i# #Rʉ#ˉ#*+###eΉ#M#f$٬"#id#M# ܉# ܉#C݉#0#w0#L0#0# @#@#0#H0#4 0#+"0# 0#70#"|#-|##- #0# 0# <#0#0#0#e0#0#0# 0#i#i# #cap#-#;-#_#o#V# # #Jp#sp# # # # q# # #  ?# `?# \# !# _7## $7##   # `  # ]  # { =## :  =##  #  # # YM## # g# 0# n 0# g # g #H% !! M#|!!P #srv!"# D  #z G#G G#  G# #R #  #$;# P#( P#,( P#0 i#4 i#<  px ƞ#sv #D w#  w# T< 0# iid ʉ#E ʉ#sid ʉ#   x# | iid Љ#px ў#buf 0#sid 0# ptr ԉ#bol Չ# & ˒|    P P yEg ,u[v#t0w#t1w#5x#Vy#z# z{#$|#( G#len0#pos0# sid0#srv#oe#src#buf #!beu (! W0#<M# [! srv[!#? #. # !Xact#bck#, !act#bck# "##g #7# ###B #map(!# Ha!#, !# "#m4"#5"#"#"#"" %# щ#0҉#5Ӊ#7ԉ# <Չ# ։##׉#؉#*%# 1# M# ]# !/$wDU"dstW"src "strvV#o/$$Jp%#&len#S&num#P'X$/7Q$/7P%$ (2'p(35$ !p$,EvPU"strDvS&errFvV!$]fv3U#d$S#*dER#ReR#{evV)expg?*&errjvP?+4K$$ >+L %% ~+BM % 5% ,%%%+$T%+T%+ tt%+ u %- +$Q%nc26r@` R0A@p  "0 #[< %m7 &BM 5into 60 =b >E ?E @P AE BE3 Ct DtAI8 SV UM ln q  0 '-s '-S<(#/( #( # ( #  (#{(#O(#/ (#z(# (#$`(#((#, (`#0(f#4.(#8(#<(#@ (">#DX (##F($l#Gb((|#H(1P#L (7f#T+(8f#XK(:#\(<#`  7 f d(`! ( U(`# (f# (#)s | "  3BGQ:F$" !D !E$# X!F/#2>q40Y .  p#$[>m#  9# m# }   9# # #  w  9# #  #  # 7 rr s# Ot# u# v# w#D\"3 "4# "5# "6# "7# "8# "9# ":#,#, #-# Y#.# #/# #0# Q8X&% &&# &'># }&)# &-# &.# &/# &0# &1# +&2>#( &4#, &8:#0 F&;E#4 &?$#8 &@[#< &A$#@ &B[#D D&C$#H &D[#L &F[#P &G[#T t  b t#  Q  O Y# # # bit #u32 "09 * > +#key ,#- n -#p -#\  - #ref !-#p H 0wq 1#rq 2# . 3#0  4#4  50#8  6#< N 7f#@  8#D\ 4w d x# y# z0# E {0# %|0# r}0# ( ~0# T<0# -0#$ u #(   j '8+H . +I0# +J0# B+Kf#fd+L# T<+M0#exp+N0# 2+O| # 2+P| # 2+Q| # 2+R| #$ib+S #(ob+S #,  +T0#0 +Uf#4v v  j  +S T< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$ > 0#(  0#, 0#0  0#4  #8 & #< 7#@  7#A m#D J v #L  v #P  #T #X  X- tstr u#len v#       z ,# L,# p ,# ,P#fe,#be,# ,# T<,#$ ,0#(req, #,rep, #0si,!#4 a ,}# d",}# \,#srv,,# ,,# ,,# ,!#txn,# * ,# W,# ,!# M/,!# ,# ,Í# ,׉!# ,0#  ]+n   9# !#  kC auid^#gid_# L`#V buxa]LfdM# . N# O# ;P}# QJ# KR# +"S# T0# VUP# V# F'Wf# X# f$Yl# Zf#  [0# mbC# 'c#J TQ umr# +n# o# p# ` q9# r.# s#$ 1tf#( 2uf#, Jv#0 w#4 x#8 vy#< /z#@ ,{#H |#L]VfV  J*Cf*Af#b*B # *?cb*C# B*Df# . *E7#ev*F7# O *Gr# *H.# (    N# # # r[# #- a ^f# _%# 2`%#a+ V,# *-# R.# {/#   N ) -# &`#ZZN/8len/90#cr/:0#V/;0# /Cv/D# ( /E# /F# X'/G# 0/H# fA.QQ  g-D   ..l.ݟ#m_l.ޟ#u.ߟ#u_l.ߟ# v.#v_l.#.l.#v_l.#c.#c_l.# r.#r_l.#.rq.Lst.@. .0#sol.#eol.#som.0# col.0#sov.0#eoh.0#cap.#sl.# 4 .m#8M. X0.A# .# . #req.#rsp.#Xuri.# V .# >.# AE.# T<.0# B  0#  0# 0#,<TH VI,# . J# K# hL# M# Z N# O# h%Q# /R# S#$ S#( +"T0#, 6T0#0 U#4 U#8 V#< W#@ X#H ;Z#L [#\ ;]#l __#| o`# @b,# 6b,# c# d# Ne# }f# g# ;g# {!h# r h# h# i# j# Fk#idm# n0#  n0# o0# p0# q0# ur0# Vr0# gs# , t# hu,# w0# w0# x0# y# {0# {0# |0# e|0# }0# ~M# x0# 4 0# # # #h%DQ P# F # # . # # 9# L# I# ##,acl#0 #8 r#@ #H F;$#Psrv,#\  #` #d $#h U# # # S# # 0# ß# ğ# # Ɵ# "ǟ# i%# # Rʟ# ˟# *̮&# # eΟ# # f$ٸ%#id# # ܟ# ܟ# Cݟ# 0# w0# L0# 0# M# M# 0# H0# 4 0# +"0#  0# 70# "# -# # - # 0# 0# # 0# 0# 0# e0# 0# 0# 0# # # #cap# # ;# _# o# V#  "#  "# J# s### #q### #`#\#!#_'#$'# #` #] #{ '#:  '# # ##Y,'##g#0#n 0#s##s##H2Y - - # |-! #srv-",#  D, ,# z,# G ,# ,# ,# R,# ,#$ ;#,[#(  ,[#, (,[#0 ,#4 ,#<!,px,ƫ#sv,,# D,ȍ# ,ȍ# T<,0# iid,ʟ# E,ʟ#sid,ʟ#-! , ,3#!,iid,П#px,ѫ#buf,0#sid,0# ptr,ԟ#bol,՟#!, &,˟ |,! ,-! ! ! !! v !yE!X"acl%*%+#u%,#1?%-#  %.#%/0#!"I?%>%?#%@#pol%A#%B0#R+%C#"p7 ;4Dun5 in6"Jp2u7"#s# ,u [vY#t0wY#t1wY# 5x# Vy# z# z{#$ |#(# #len0#pos0# sid0#srv,#oe#src}#buf #$be u4$  W0# <#g$ srvg$# ? # . #,$Xact"#bck"#,$actY#bckY#% # # g # 7# # # # B ,#map4$# Hm$#, $# %# m4%# 5%# %# %#%,%1&  џ# 0ҟ# 5ӟ# 7ԟ# <՟# ֟# #ן# ؟#&*  m&# '# Y(# 63)# T<*# -+)# ,C)# V-&#1&'  V'# u# Z#len # !# A"#& ,'  <' "^'#4#u'#@'#be<'# ^"3(A(!"#@#'#E$# %#%&# '#T<(0#)# *#$i(: $, $-#kw$.# $5(#(i(($= $>#kw$?(# (3($)  V)# # #(C)J  VC)# # # ))2Q 2M# 2N# 2O# | 2P# *2;uid2<#gid2=# 2># +"2?# 2@# 2A# 2B# *2C# L2D# 2E#$ 2F#( 2G#, '2H#0 J2I#4 s2I#8 2J#< 2J#@  2K"#D  2K"# 12QI)# x 2RV# c2S#+S uT#valU0#capV0# W0# %,P@HU&str~'0PV(lPP(cP)V~)S)^~)TS(endW*u+,(ss}~,+-__sf.,,6=/,0,6=/ -/-/#-.I,,=G/,0,=G/ -/-/#-.},,GX/,0,GX/ -/-/#-,,u{(__v>P1(__v>P+,-__sf2(he0-P3,n4m30- -4+4?+4=,5-PU6h%V7capQ6*6R+7arg6 8msgS0-/-9-2:h%154ZU6*6/ 6l;7inv+c.;\%;%,.";\ %; %,.@M;\#%;#%,.Q^;\&%;&%,.;\)%;)%,!/;\,%;,%,G/;\/%;/%,m/ ;\2%;2%,/"/;\5%;5%,/@M;\8%;8%./,m|/,0,m|/ -/-/#-,0;\C%;C%.G0,/,0,/ -/-/#-,0;\N%;N%1;PN<NP.0,"/,0,"/ -/-/#-+0< f4P,'1Hj;\Y%;Y%1Hj;PY<YP.[1,/,0,/ -/-/#-+s1 <v4P,1;\e%;e%,1 ;\u%;u%+1P__s2f04d/5? 5%8:h%75ZGpaU6*F6/F 6l;F7invF<Hj<I,S8errJP8rcK}8valL0~+5;\N%;N%,5;\P%;P%,6$;\t%;t%.66-BX/-.M64/5.q6Z @ [~@[~,6;\R%;R%,6;\T%;T%+6;\%;%,7r;\%;%+g7<P~<~,T7(7;\0%;0%28l2PS,7;\G%;G%,78lIPP,7;\]%;]%,7]j;\j%;j%,8r;\|%;|%,?8;\}%;}%,8;\%;%1;P<P+80.>;\^%;^%+>>hdr_',p>a;\f%;f%1a0>hdrw'+ ?H< A P<=A S8fdA V8errB }<8C ,~,0?~;\v%;v%,V?;\v%;v%,?;\~%;~%1P,J..;\[%;[%1..;P[<[P2p__vf>,VK[0e0>__ve>,|K00;\t%;t%,K00;\y%;y%,K00;\~%;~%,K0 1;\%;%,L1&1;\%;%,:L.1A1;\%;%,`LI1\1;\%;%,Ld1w1;\%;%,L11;\%;%,L11;\%;%,L 22;\%;%,M$272;\%;%,DM?2R2;\%;%,jMZ2m2;\%;%,Mu22;\%;%,M22;\%;%.M,23/,0,23/ -/-/#-+N8errP,(NA3T3;\%;%,NN33;\%;%,tN@4S4;\%;%,Nw44;\%;%,N-5@5;\%;%,N55;\C%;C%, O55;\*%;*%.@O,67/,0,67/ -/-/#-.tO, 7%7/,0, 7%7/ -/-/#-.O,-7I7/,0,-7I7/ -/-/#-+O>w0,Q7o7/,0,Q7o7/ -/-/#-+P8errP+P8errP+4P(8errP.hP,99/,0,99/ -/-/#-.P,99/,0,99/ -/-/#-,P:;;\y%;y%1:;;Py<yP+0Q@;;\}%;}%,VQu;;;\%;%,|Q;;;\ %; %,Q;;;\ %; %,Q;;;\ %; %+Q`<* !S,Q<~><V,"R~>>;\. %;. %+:Rx<*/ !S+RR<* !S+jR<*E !S+R<},R?@;\%;%1(@:@;\%;%,R@@;\%;%,SBAQA;\%;%,>SBB;\D %;D %,dSdCsC;\%;%,SCC;\%;%,SCC;\%;%+S<0~,SDD;\%;%,TDD;\%;%, ,R2 8pxz m8srv{ ,VE)LMaSa EB)MMaE*traE*u aF E0QaE  Gh%-GF.H\HjH0jE~1;0Inow1<E2V)E/2[E2\  Sb( E3`b CbEe3E3E4Q0EQ4R0E4U0Ej 4VE 4Wb b ~Hf9b` b bb  *)U[c  b (cb )3w9c c)j)&2j)Y(\# Rsr ` R0Aint@p "0<7&wBo60>S?SAS3C7tDlAI8S7V U7 0 B G Q:Fe" DE#XF#k 2Lq40 Yp {  p #$L# ##  =##=# M w  # ۆ# ܜ# # E  -@ - S<># / #  #  # # {# O# / # z# #$ `#( #, #0 #4 .>#8 >#< #@ "L#D X #~#F $#G b(#H 1#L 7#T +8#X K:>#\ <#` d! U## >#M  F  3   b #  9   O #  #  # bit >#u32 "0m9 *> +#key ,9#n#p#m - m#ref!#<p H 0wq 1D#rq 2D#. 3>#0 4>#4 50#8 6R#<N 7#@ 8>#DLLL<4wd x@#ym#z0# E {0# %|0#r}0#( ~0#T<0# -0#$u#(  '8H. I0# J0#BK#fdL># T<M0#expN0#2O#2P#2Q# 2R#$ibS0 #(obS0 #, T0#0U#40 ST<}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#, 0#0 0#4>#8& #< E#@E#Ae#DJ#L #P% #T+ #X_ X-tstru#lenv>#p p 0 v   zm#Lm#p L# #fe#be# ># T<>#$0#(req0 #,rep0 #0si#4a #d"#\M#srv## # /#txn#* >#WZ#A#M/X# …#Å##0#_  < ]e +n  #!e # u k auid^&#gid_#L`# buxau  LfdM>#. N>#O>#;P#  Q #KR>#+"S>#T0#VU #Vm#F'W #XR#f$Y #Z# [0#mb #'c# TQum #+n>#o>#p>#` q# r# s>#$1t #(2u #,Jv #0w #4x #8vy #</zm#@,{>#H|m#L   >> >  >  CfA #bB0 #} ?cbC}#BD#. EE#evFE#O G#H#   N##>#r^# m#X* a^#_%#2`%#az+V,z#*-#R.>#{/e# 5 *) #&# "8len"90#cr":0#V";0#\ "Cv"D\#( "E#"F#X'"G#0"H# !QQ  g-D   !b !l!>#m_l!>#u!>#u_l!># v!>#v_l!>#`!l!>#v_l!>#c!>#c_l!># r!>#r_l!>#}!rq!st! @! !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!#sl!`# 4 !e#8!X0!#! # !6 #req!}#rsp!}#Xuri!#V !#>!#AE!>#T<!0# B 0# 0#0#<THVI#. J># K>#hL># M>#Z N#O#h%Q#/R># S>#$ S>#(+"T0#,6T0#0 U>#4 U>#8V>#<Wm#@XL#H;ZM#L[M#\;]M#l__>#|o`#@b#6b#c# dM#Ne#}f># g>#;g>#{!h>#r h>#h>#i>#j>#Fk>#idm#n0# n0#o0# p0#q0#ur0#Vr0#gsD#, t#hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~#x0#4 0#w#w#>#h%DQ #F ##. ># >#9>#L>#IM#  #,aclm#0m#8rm#@m#HF; #Psrv#\ >#` >#d e!#hU# #>#S#>#0#>#>##>#">#iȋ# #R>#>#*"##e>#m#f$f"#id#m# ># >#C>#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"#-##- >#0# 0# 1#0#0#0#e0#0#0# 0#w#w# >#cap>#M#;M#_>#o#V# # #J~#s~# ># ># ># q># ># >#  z# `z# \># !># _"# $"#  # ` # ] # { "# :  "#  >#  # ># Y## ># g># 0# n 0# ! # ! #HZ   m#| !p #srv "#  D >#z<#G <# <#7#R7#  7#$;#^#( ^#,(^#0w#4w#<px#svǘ#Dȅ# ȅ# T<0# iid>#E>#sid># ͘#iid>#px#buf0#sid0# ptr>#bol># &  |΂ ֙ / #Ap 5Xp GyEp7 ;4un5< in6MJp2u7e#! ,u[v#t0w#t1w#5x#Vy#z># z{>#$|>#( <#len0#pos0# sid0#srv#oe#src#buf+ # be u W0#<m#! srv!#? >#. >#@!Xact#bck#,e!act#bck#T">#>#g >#7># >#>#>#B #map # H!#, @!# `"#m4`"#5`"#`"#`"#`"T"" >#0>#5>#7># <># >##>#>#*" " # #6 !># >r*sU"sQ!e#- >0ssU"sR#$r##r##t##u> #$ ##Q#%now$<<B1!V4s!` R0A@p  "0<7 &iBinto 60 >E ?E AE3 Ct D^AI8 SV U  0BGQ:Fe" "D"E#X"F# '-p '- S<(~# /( # ( # ( # (# {(# O(# / (# z(# (#$ `(#( (#, (R#0 (X#4 .(~#8 (~#< (#@ (">#D X (#p#F ($^#G b((n#H (1#L (7#T +(8#X K(:~#\ (<t#`   d(R! (U(R#(X# (~#p n   3  >#   # #     # # #  wF 6  7~#  8~#2>q40YF Q pg#ڏ#\# r## 7  b#  e  O# # # bit~#u32"09*>+#key,e#n#p# - #ref!#hp H0wq1p#rq2p#. 3~#04~#450#86~#<N 7#@8~#Dxxxh4 wd x# y# z0# E {0# % |0#r }0#( ~0#T< 0# - 0#$u #( - '8$H. $I0# $J0#B$K#fd$L~# T<$M0#exp$N0#2$O #2$P #2$Q # 2$R #$ib$S\ #(ob$S\ #, $T0#0$U#4-\ $ST<!}0#rex!~~#wex!~#rto!~# wto!~#cto!~#l!0#r!#w!# lr!#$>!0#(!0#, !0#0 !0#4!~#8&!E #< !7#@!7#A!W#DJ!#L !#P!Q #T!W #X X-!tstr!u#len!v~#  \  E  !z##L##p #x## #fe# #be# # #~# T<#~#$#0#(req#\ #,rep#\ #0si#%#4a ##d"##\##srv# ## # # # #%#txn#,#* #~#W#$##&#M/#&# #w##w##׷%##0# K h ] +n  #! # k auid ^&#gid _#L `# bux a   Lfd M~#. N~# O~#; P#  Q #K R~#+" S~# T0#V U # V#F' W # X~#f$ Y # Z# [0#m b #' c# T Qu m#+ n~# o~# p~#` q# r#  s~#$1 t #(2 u #,J v##0 w##4 x##8v y##</ z#@, {~#H |#L   ~~ ~  #~ J)Cf)A #b)B\ # )?cb)C#B)D#. )E7#ev)F7#O )G#)H# ) 9<)])^#)=)_#set)`#clr)a# =)b#=)c#rem)d#clo)e#1)f# 5)g#$@>)h#(")i#,C)j#0u)k#4%)l~#8~~ ~~~=p7;4un5h in6VJp2u7#,Q,M~#,N~#,O~#| ,P~# ,;uid,<~#gid,=~#,>~#+",?~# ,@~# ,A~#,B~#*,C~#L,D~# ,E~#$,F~#(,G#,',H#0J,I~#4s,I~#8,J~#<,J~#@ ,K=#D ,K=#1,QV#x ,R #c,S~#&8len&90#cr&:0#V&;0#m &Cv&Dm#( &Ew#&Fw#X'&Gw#0&Hw# %   Q Q    g - D   %s%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#q%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%&@% %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%&#sl%q# 4 %W#8%X0%#%# %b #req%#rsp%#Xuri%#V %#>%#AE%~#T<%0# N##~#rP# #a a^#_%#2`%#a.+V,#*-#R.~#{/# l a) #&#yEh%D #F r#r#. ~# ~#9~#L~#I# !#,acl#0#8r#@#HF;!#Psrv #\ ~#` ~#d j"#hU# #~#S#~#0#~#~##~#"~#i# #R~#~#*###e~#ϙ#f$k##id#ۙ# ~# ~#C~#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"r#-r##- ~#0# 0# 1#0#0#0#e0#0#0# 0#i#i# ~#cap~##;#_~#o#V # =# =#Jp#sp# ~# ~# ~# q~# ~# ~#  # `# \~# !~# _## $##  (# ` (# ] (# { ## :  ##  ~#  # ~# Y $# ~# g~# 0# n 0# &!# &!#H B 0# 0#0#  #|! #srv" #  <T"VI #. J~# K~#hL~# M~#Z N#O#h%Q #/R~# S~#$ S~#(+"T0#,6T0#0 U~#4 U~#8V~#<W#@Xx#H;Z#L[#\;]#l__~#|o`#@b #6b #c# d#New#}f~# g~#;g~#{!h~#r h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#ur0#Vr0#gsp#, t #hu #w0#w0# x0# y1#{0#{0#|0#e|0#}0#~#x0#4 0#i#i#~#&! ,u[v#t0w#t1w#5x #Vy #z~# z{~#$|~#(!<#len0#pos0# sid0#srv #oe #src#bufW #!be u! W0#<#" srv"#? ~#. ~# E"Xact #bck #,j"act#bck#Y#~#~#g ~#7~# ~#~#~#B  #map!# H "#, E"# e##m4e##5e##e##e##e# Y## ~#0~#5~#7~# <~# ~##~#~#*# # $ $b $D# #~#z#<#G #<# #<###R##  ##$;##P#( #P#,(#P#0#i#4#i#<D%#px# #sv#ǟ #D#w# #w# T<#0# iid#~#E#~#sid#~#[% ###%#iid#~#px# #buf#0#sid#0# ptr#~#bol#~#%#&#$|#D%#[% %- & %&  &!m& 1ssU"be0 S#Y&m&ss$~&%m&ss$~&&&2'h%1 ('S!=~ttU"s< P)pc>%R*: >%V*} >%W* ?~p+ *|B S%'FtLt,"'S$+'&5'hx-tgx-fg0('(!Y~tuU"sX V* Z~W+ .|` /pa%#''tt,'P%'tt,"'S$+'&' ;%-px;'' !:(h!t uvU"ss V)srvu S)msgvb h* w~W+ * z~d!(:!vyU"s V)srv S)msgb h* ~W!(  ylzU"s S)srv S)msgb h* ~W0) pz{U1s S2srv S2msg b h3 !~W4O*!M~{}U1fdL~V5r {5H!{5 |5!|2tOxW2sP S#)'{{$"'$+'6) 2ret]~P7<|O|8 d~7<|C|9__vd06* 2sa7|}9__v>%O*c}k}$`*$k*%w*c}k},*P$*&w*!W~-nowV~'f$V~&*A L~-nowK~'f$K~43+ ~}(U1fd~5r ~2len~S2tx`2s \3!~d3!h%'~~$"'$+':w.\ x0ֈU1t x3J ~L2s W2saX2fd~S2rv~V5!F#+w.,.P,.R#+w.Ȁ$.$.#,w.?X$.,.P##,w*Xg,*P$*#C,w*-I,*S,*P#a,w.$.,.P#,w*,*P$*#,w.x$.,.V6- 8!~#,w*,*S$*#,w*,*P$*%.Մ$.$.;!-Va9__vB>6V-( 3!I.V2retJ~P3T<J~H6-@ 3!h.V2reti~P3T<i~D%m&,~&P#-.is$.#-w*Շۇ,*P,*P;'.D8!~#.w*!,*S$*%.!7$.$.#C.w.DX$.$.#a.w*Xg,*P$*%m&s,~&P&.yk~'j~-nowj~&. u~-t1t~-t2t~<.h T-fdS~=/!%~4U2px' p2s( S9t)x3!*~l3x!*~h3!*~d#//؉>/+X >/6/x ?/V%/ĉˉ$0#/w*؉ۉ,*W,*P% 0C_$0&/S x/tx@/__p& 03x-tx<%0'p xA$'20eA'20AU )oA)t_0JA)u~ 0B A*Qr0A~+;0Cnow+<<A+=<A,VA,\W Cone,^A,_0 Dh%- AQ0AQR0AU0Aj V(A W?1pi&m%G`@!` R0Aint@p  "0<7 &wBo 60 >S ?S AS3 C7t DlAI8 S7V U7  0BGQ:Fe" DE#XF#  n # p #e - e# ref !#R4wd xR#ye#z0# E {0# %|0#r}0#( ~0#T<0# -0#$uX#( h n 2Lq40Ys ~ p#$ L# ##  @##@# P w#ۉ# ܟ## E  #-C #- S<$># /$ # $ # $ # $# {$# O$# / $# z$# $#$ `$#( $#, $#0 $#4 .$>#8 $>#< $#@ $"L#D X $#~#F $$#G b$(#H $1#L $7#T +$8#X K$:>#\ $<#`d$! $U$#$# $>#J  C  3 b#  6  O# # # bit>#u32 "0j9 *> +# key ,6#p H 0 wq 1A# rq 2A#. 3>#0 4>#4 50#8 6#<N 7#@ 8>#Dj'8 H. I0# J0#B K# fd L># T< M0# exp N0#2 O#2 P#2 Q# 2 R#$ ib S0 #( ob S0 #, T0#0 U#40  ST<}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#, 0#0 0#4>#8& #< E#@E#Ae#DJ#L #P% #T+ #X_ X-t stru# lenv>#p p 0 v   ze#Le#p # # fe# be# ># T<>#$0#( req0 #, rep0 #0 si#4a  #d" #\P# srv## # /# txn#* >#WZ#A#M/X# …#Å##0#_  < ]e +n  #!e # u k a uid^&# gid_#L`# buxau  L fdM>#. N>#O>#;P #  Q #KR>#+"S>#T0#VU #Ve#F'W #X#f$Y #Z# [0#mb #'c# TQum #+n>#o>#p>#` q# r# s>#$1t #(2u #,Jv #0w #4x #8vy #</ze#@,{>#H|e#L   >> >  >  %C f%A # b%B0 #} %? cb%C}#B%D#. %EE# ev%FE#O %G#%H#   N##>#r^# e#* a^#_%#2`%#az+V,z#*-#R.>#{/h# 5 *) #&# "8len"90#cr":0#V";0#\ "C v"D\#( "E#"F#X'"G#0"H# !QQ  g-D   !b ! l!># m_l!># u!># u_l!># v!># v_l!>#`! l!># v_l!># c!># c_l!># r!># r_l!>#}!rq!st! @! !0# sol!# eol!# som!0# col!0# sov!0# eoh!0# cap!# sl!`# 4 !e#8!X0!#! # !6 # req!}# rsp!}#X uri!#V !#>!#AE!>#T<!0# B 0# 0#0#<THVI#. J># K>#hL># M>#Z N#O#h%Q#/R># S>#$ S>#(+"T0#,6T0#0 U>#4 U>#8V>#<We#@X#H;ZP#L[P#\;]P#l__>#|o`#@b#6b#c# dP#Ne#}f># g>#;g>#{!h>#r h>#h>#i>#j>#Fk># idm#n0# n0#o0# p0#q0#ur0#Vr0#gsA#, t#hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~#x0#4 0#w#w#>#h%DQ #F ##. ># >#9>#L>#IP#  #, acle#0e#8re#@e#HF; #P srv#\ >#` >#d e!#hU# #>#S#>#0#>#>##>#">#iȋ# #R>#>#*"##e>#e#f$f"# id#e# ># >#C>#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"#-##- >#0# 0# 1#0#0#0#e0#0#0# 0#w#w# ># cap>#P#;P#_>#o#V# # #J~#s~# ># ># ># q># ># >#  z# `z# \># !># _"# $"#  # ` # ] # { "# :  "#  >#  # ># Y## ># g># 0# n 0# ! # ! #HZ  e#|!p # srv"#  D >#z<#G <# <#7#R7#  7#$;#^#( ^#,(^#0w#4w#< px# svǘ#Dȅ# ȅ# T<0# iid>#E># sid># ͐# iid># px# buf0# sid0# ptr># bol># &  |΂ ֙ / #Ap 5Xp GyEp7 ;4un5< in6PJp2 u7e#! ,u[v# t0w# t1w#5x#Vy#z># z{>#$|>#( <# len0# pos0# sid0# srv# oe# src # buf+ # be u W0#<e#!  srv!#? >#. >#@!X act# bck#,e! act# bck#T">#>#g >#7># >#>#>#B # map # H!#, @!# `"#m4`"#5`"#`"#`"#`"T"" >#0>#5>#7># <># >##>#>#*" " # #6 !`#"'0@U"s&`#S#max(0V$% "60f# &">U'#@"U"p/Q$#%j!]$!ap wU"srv`V"px`W#psb/Q(ppb/)|cp S*'$]$+n$*>$x$+$,$ό-$p-$l.x$N"1//s1`#.$ ;//px;$$ .$>/tv1$/tv2$$ <'?%!CߍU"sBV#pDp)+"E>W$ҍ)|Mp P,?%ҍ-P%S+Y%.c%h/tg/fg0!%3"/U0|p S(p/1 #__pQ2$#%2#%2%t%2%u> %3 2&Q%4now<<5 2Q02QR02U02j V2 Wf&A)5%(e"` R!0A@p "0<7&iBinto60>E?EAE3CtD^AI8SV U 0BGQ:Fe" #D#E#X#F# )-p )- S<*~# /* # * # * # *# {*# O*# / *# z*# *#$ `*#( *#, *j#0 *p#4 .*~#8 *~#< *#@ *">#D X *#p#F *$v#G b*(#H *1#L *7#T +*8#X K*:~#\ *<#`    ,  d*j! *U*j#*p# *~#3p,3$># ## "##"#2w^6 7~# 8~#2>q40Y^ i p#ڧ#t# ܊##7 b#--}  O# -# -# bit~#u32"09*>+3#key,}# n #p # - #ref !#p H 0wq 1#rq 2#. 3~#0 4~#4 50#8 6#<N 7#@ 8~#D 54"wd "x#"y#"z0# E "{0# %"|0#r"}0#( "~0#T<"0# -"0#$u"5#(E '8$H. $I0# $J0#B$K#fd$L~# T<$M0#exp$N0#2$O%#2$P%#2$Q%# 2$R%#$ib$St #(ob$St #, $T0#0$U#4  Et $ST< }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 ~#8& ] #< 7#@ 7#A W#DJ #L #P i #T o #X+ X- tstr u#len v~#  t  ]   z #L #p # #fe y #be y #  ~# T< ~#$ 0#(req t #,rep t #0si "#4a #d" #\ #srv # # # "#txn #* ~#W # "#M/ "# w# w# W"# 0# c  ] +n  #! # k auid^&#gid_#L`# buxa  LfdM~#. N~#O~#;P#  Q #KR~#+"S~#T0#VU #V#F'W#X#f$Y#Z# [0#mb #'c# TQum#+n~#o~#p~#` q# r# s~#$1t#(2u#,Jv;#0w;#4x;#8vy;#</z#@,{~#H|#L  ~ ~ ~+;~ +b+Cf+A#b+Bt # +?cb+C#B+D#. +E7#ev+F7#O +G#+H#A9<+]+^#)=+_#set+`#clr+a# =+b#=+c#rem+d#clo+e#1+f# 5+g#$@>+h'#("+i#,C+j#0u+k#4%+l~#8~  ~ ~     ~~  ' Up7;4un5 in6nJp2u7-#,Q,M~#,N~#,O~#| ,P~# ,;uid,<~#gid,=~#,>~#+",?~# ,@~# ,A~#,B~#*,C~#L,D~# ,E~#$,F~#(,G#,',H#0J,I~#4s,I~#8,J~#<,J~#@ ,KU#D ,KU#1,Qn#x ,R #c,S~#H N##~#rP# # a ^# _%#2 `%# aY+V,#*-#R.~#{/#  ) #&(# " "He B 0# 0#0#'8len'90#cr':0#V';0# 'Cv'D#( 'Ew#'Fw#X''Gw#0'Hw# e@&   Q Q    g - D   &&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#&rq&Kst&@& &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&ڮ#sl&# 4 &W#8R&X0&@#&# &z #req&#rsp&#Xuri&#V &#>&#AE&~#T<&0#<THVI#. J~# K~#hL~# M~#Z N#O#h%Qy #/R~# S~#$ S~#(+"T0#,6T0#0 U~#4 U~#8V~#<W#@X#H;Z#L[#\;]#l__~#|o`#@b#6b#c# d#New#}f~# g~#;g~#{!h~#r h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, t #hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~.#x0#4 0#i#i#~#Ry h%DQ #F ##. ~# ~#9~#L~#I# ##,acl#0#8r#@#HF;##Psrv#\ ~#` ~#d $#hU# #~#S#~#0#~#~##~#"~#i# #R~#~#*%##e~#ϱ#f$ـ%#id#۱# ~# ~#C~#0#w0#L0#0# .#.#0#H0#4 0#+"0# 0#70#"#-##- ~#0# 0# 1#0#0#0#e0#0#0# 0#i#i# ~#cap~##;#_~#o#Vy # U# U#Jp#sp# ~# ~# ~# q~# ~# ~#  # `# \~# !~# _ &# $ &#  S# ` S# ] S# { &# :  &#  ~#  # ~# Y!&# ~# g~# 0# n 0# ;## ;##H %% #|%! #srv%"# m!D  ~#z <#G <#  <# #R #  #$;# P#( P#,( P#0 i#4 i#<! px y #sv #D w#  w# T< 0# iid ~#E ~#sid ~#!  #W" iid ~#px y #buf 0#sid 0# ptr ~#bol ~#" & m!| ! !"E " " " ";# ,u[v#t0w#t1w#5x #Vy #z~# z{~#$|~#(#<#len0#pos0# sid0#srv#oey #src#bufo ##bey u# W0#<#/$ srv/$#? ~#. ~#Z$Xact"#bck"#,$act#bck#n%~#~#g ~#7~# ~#~#~#B #map## H5$#, Z$# z%#m4z%#5z%#z%#z%# z% n%% ~#0~#5~#7~# <~# ~##~#~#*% &!& 1&z &g#(dow(~#h1(~#m1(~#h2(~ #m2(~#&(min(i#max(i##(~#"(~#&(;(ϊ#k(Њ#.'(i(~(͏&m"(&k#(1&X'(ptr(str(reg(X''[#,((Ʊ#val(&#ptr(.'##(# len(~#$T<(~#(' (p(i(~ll(id('a('yE (^("0(i(~#ptr(#len(~#T<(~# ctx('#("(kw(# ((# 3#(x)# j>()# (0# <$( ~#(~  ( ^'()~ y  ~ ) r))r) >( (!#kw(")#arg(%)# #(&~# "('# (()~ r) (~))#( (#kw()#)^(!")(%#str($^($A*`"/ U%s. S&Z0p'A*Ɏ̎(R*)\*V)f*W*r*+$.~+fd.~+sa.r*,".x*-/@'@~ 'U%fd@~.lA }.pBy W/sC .txnD/}/tE.cfdF~}&$G~}09# 0"0#0C#0"0"}0$]0r"G1t- &;P~&#Q}1+ .__pnV2+/-o3/4 3/1+5/}'/hn(/2+/(/2,/(/2/,04@)0Q(01W,(6pn@/0~6sn@/0}1,H6lenR~P7~ܔ6pnb/0}78__vi>1,`6__poR2,?0(L02,X0(e01,x6__pR2-?0(L02*-q0qw(~02F-0IO(0(0'0Ɨ(0'0)0S(09-6pnX~78__v_>1-6__pQ9- 8__s1-6__pQ9 .IY8__s1#.6__p!Q2K.0)0P7309i.(6msgz }9..u6msgz }9.u.maxJ~P9.Ǜқ8__vK>1.8__vJ>1&/6pn0~6sn0~9/ל8__v;>4 8__v:>2=/0(09W/:j2n/1(1'1(1*/S /t;/__p*/3+tpxy >l4 R>l7>dir~?1?)?"r)Q=12$~ӠU>pxy >l4 P>l7>dir~?1?)?"r)R928__v>78__v>=2" ~\U>px y >l4  S>l7 >dir ~?1? )?" r)V=C3"~`ۡU>pxy >l4 S>l7>dir~?1?)?"r)V9,3{8__v&>78__v$>=3#0~U>px.y P>l4.  >l7.>dir.~?1?/)?"/r)P@~#FUA$)3eA)3AU +oA+t4bA+u~A +v~A ,Z~?4BA-Q.4A~;0Cnow<<A=<A,VA,\o Cone,^A,_4 2A $SA .SA .AQ0AQR0AU0Aj VSA W5DS#7)\1+dn V%` R0A@p  "0<7 &iBinto 60 >E ?E AE3 Ct D^AI8 SV U  0BGQ:Fe" DE#XF#  ># p##  p###  w 2>q40Y M p'#p## 2## 7  -@ - S< ~# / #  # # # { # O # / # z #  #$ ` #(  #, #0  #4 . ~#8  ~#<  #@  ">#D X #p#F  $#G b (#H  1#L 7#T + 8#X K :~#\  <#` d ! U # # ~#M  F  3 b#  9  O# # # bit~#u32"0m9*>+#key,9# n #p #m - m#ref !#<p H 0wq 1D#rq 2D#. 3~#0 4~#4 50#8 6R#<N 7#@ 8~#DLLL<4wd x@#ym#z0# E {0# %|0#r}0#( ~0#T<0# -0#$u#(  '8"H. "I0# "J0#B"K#fd"L~# T<"M0#exp"N0#2"O#2"P#2"Q# 2"R#$ib"S0 #(ob"S0 #, "T0#0"U#40 "ST<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0 0#4~#8& #< 7#@7#AW#DJ#L #P% #T+ #X_ X-tstru#lenv~#p p 0 v   z#m#L#m#p #L## #fe#m#be#m# #~# T<#~#$#0#(req#0 #,rep#0 #0si#u #4a ##d"##\#M#srv#### ## # #txn#q#* #~#W### #M/# # #w##w##K ##0#_  < ]e +n  p#!e # u k auid^&#gid_#L`# buxau  LfdM~#. N~#O~#;P#  Q #KR~#+"S~#T0#VU #Vm#F'W #XR#f$Y #Z# [0#mb #'c# TQum #+n~#o~#p~#` qp# re# s~#$1t #(2u #,Jv #0w #4x #8vy #</zm#@,{~#H|m#L   ~~ ~  ~  !Cf!A #b!B0 #} !?cb!C}#B!D#. !E7#ev!F7#O !G#!He#  {r9!h#("!i#,C!j#0u!k#4%!l~#8~~ ~r~~< N##~#rP# m#X a^#_%#2`%#aM+V,#*-#R.~#{/#   ) #&#< a&8len&90#cr&:0#V&;0# &Cv&D#( &Ew#&Fw#X'&Gw#0&Hw# "%QQ  g-D   %_%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%_k@% %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%k#sl%# 4 %W#8%X0%#%a# %6 #req%#rsp%#Xuri%#V %#>%#AE%~#T<%0#F B 0# 0#0#<THVI#. J~# K~#hL~# M~#Z N#O#h%Qm#/R~# S~#$ S~#(+"T0#,6T0#0 U~#4 U~#8V~#<Wm#@XL#H;ZM#L[M#\;]M#l__~#|o`#@b#6b#c# dM#New#}f~# g~#;g~#{!h~#r h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#ur0#Vr0#gsD#, ts#hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~#x0#4 0#i#i#~#Fmh%DQ #F 2#2#. ~# ~#9~#L~#IM# !#,aclm#0m#8rm#@m#HF;"#Psrv#\ ~#` ~#d "#hU# #~#S#~#0#~#~##~#"~#i# #R~#~#*;$##e~#m#f$ټ##id#m# ~# ~#C~#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"2#-2##- ~#0# 0# 1#0#0#0#e0#0#0# 0#i#i# ~#cap~#M#;M#_~#o#Vm#  #  #Jp#sp# ~# ~# ~# q~# ~# ~#  # `# \~# !~# _G$# $G$#  G# ` G# ] G# { M$# :  M$#  ~#  # ~# Y]$# ~# g~# 0# n 0# w!# w!#H $$ m#|$!p #srv$"# aD# #~#z#<#G #<# #<###R##  ##$;##P#( #P#,(#P#0#i#4#i#<#px#m#sv##D#w# #w# T<#0# iid#~#E#~#sid#~# ##͘#K #iid#~#px#m#buf#0#sid#0# ptr#~#bol#~#u # &#a |# #  y p   p  yE p7 ;4{un5< in6M Jp2u7 #w! ,u[v#t0w#t1w#5xs#Vys#z~# z{~#$|~#(!<#len0#pos0# sid0#srv#oem#src#buf+ #"bem u8" W0#<m#k" srvk"#? ~#. ~#"Xact #bck #,"act#bck##~#~#g ~#7~# ~#~#~#B #map8"# Hq"#, "# ##m4##5########5$ ~#0~#5~#7~# <~# ~##~#~#*5$ A$ ]$ m$6 $: *,*-~#kw*.#*5$#$~k~mm~$$*=*>m#kw*?$# %m$!J%'Q'M~#'N~#'O~#| 'P~# &';uid'<~#gid'=~#'>~#+"'?~# '@~# 'A~#'B~#*'C~#L'D~# 'E~#$'F~#('G#,''H#0J'I~#4s'I~#8'J~#<'J~#@ 'K #D 'K #1'Q %#x 'R #c'S~#"&y$2 WU#cap1~R"&%B`U$LB~R%l)Z$Y~U$l;Wk$W~ $h%Wm$)%Xm#errX$=X~&f$Z0p&[~l'cap[~W'res\P&u\S'tv] h'td^ V('8)\c%)c%*'͢ڢ)\g%)g%*(ޢ)\g%)g%++(l)DJ,})*O(ģѣ)\l%)l%*s(գ)\p%)p%*(DQ)\t%)t%*(Ua)\t%)t%*(er)\y%)y%*)v)\y%)y%*'))\~%)~%*K)%)\%)%-GU)\%)%.)2/h%1m%*$~U$l;kS$~ $h%m$)%m#err$=~&~l0cap~'resp)u'tv*W0td*'val0V(k*X)\%)%**ĥԥ)\%)%+**,*1*P,*2l)pv,})03+$3P414?1k4=2~"+L%mͧU$u$L~ #cap~W&mS&ymp*+(=)\%)%++l)`o,})2l)or,})5),%ЧJU6px),W7u 8|%S8yV-9\%9%/, 5,$3~PU72mS7*2V+,l),})+,l)Шݨ,})+,l),})+,l)2?,})2l)n{,})5-$X~;U7$W~8YmV8Z S8U$[~W:err[~~8F%\~~:msg]-~+x-l)ê,})2l),}) - c;- @U:pmS2-ī1-P1-P..A L~t~+ /\/ 1m/Q,x/2/ ,/,/+'//$@1/Q,/2/1/Q,/2-1-S,-./$~__vj>-mw>__vh>?$U@$0@0@U !o@!t0@!u~@ 'Z~ 0A @(Q0Bh%(mBF)~p]@~);0Cnow)<<@'VJ%B/'~@'`~8/%z$t]j6/nvR'` R0A@p  "0<7 &iBM 5into 60 >E ?E AE3 Ct D^AI8 SV U  0BGQ:Fp"  D E#X F# &-{ &- S<'# /' # ' # ' # '# {'# O'# / '# z'# '#$ `'#( '#, ']#0 'c#4 .'#8 '#< '#@ '">#D X '#p#F '$i#G b'(y#H '1#L '7#T +'8#X K':#\ '<#`  d']! 'U']#'c# '#&{ y   3 $ >#   # #    # # # % wN+n  #!N# ^ k2>q40Y^ i p#ښ#t# ܊## 7  b# -- }  O# -# -# bit#u32"09*>+3#key,}# n #p # - #ref !#p H 0wq 1#rq 2#. 3#0 4#4 50#8 6#<N 7#@ 8#D54wd x#y#z0# E {0# %|0#r}0#( ~0#T<0# -0#$u5#( E '8!H. !I0# !J0#B!K#fd!L# T<!M0#exp!N0#2!O%#2!P%#2!Q%# 2!R%#$ib!St #(ob!St #, !T0#0!U#4Et !ST<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8&] #< 7#@7#AW#DJ#L #Pi #To #X+ X-tstru#lenv#  t  ]  z#L#p # #fe@ #be@ # # T<#$0#(reqt #,rept #0siH"#4a #d"#\#srv## # X"#txn{#* #W #j"#M/"# w#w#"#0# c ] auid^1#gid_#L`&# buxa  LfdM#. N#O#;P#  Q #KR#+"S#T0#VU #V#F'W #X#f$Y #Z# [0#mb #'c# TQum #+n#o#p#` q# r# s#$1t #(2u #,Jv#0w#4x#8vy#</z#@,{#H|#L       )(Cf(A #b(Bt # (?cb(C#B(D#. (E7#ev(F7#O (G#(H#  }9<(](^#)=(_#set(`#clr(a# =(b#=(c#rem(d#clo(e#1(f# 5(g#$@>(h#("(i#,C(j#0u(k#4%(l#8 }p7;4un5%in65Jp2u7#v)Q)M#)N#)O#| )P# );uid)<#gid)=#)>#+")?# )@# )A#)B#*)C#L)D# )E#$)F#()G#,')H#0J)I#4s)I#8)J#<)J#@ )K#D )K#1)Q5#x )R #c)S# N###rP# #S a^#_%#2`%#a +V,#*-#R.#{/# ^ S) #&#, B 0# 0#0#k$8len$90#cr$:0#V$;0# $Cv$D#( $Ew#$Fw#X'$Gw#0$Hw# ,#   Q Q    g - D   #i#l#݉#m_l#މ#u#߉#u_l#߉# v##v_l###l##v_l##c##c_l## r##r_l###rq#st#iu@# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#u#sl## 4 #W#8#X0###k# #z #req##rsp##Xuri##V ##>##AE##T<#0#<THVI#. J# K#hL# M#Z N#O#h%Q@ #/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<W#@X#H;Z#L[#\;]#l__#|o`#@b#6b#c# d#New#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, tF #hu#w0#w0# x0# y<#{0#{0#|0#e|0#}0#~#x0#4 0#i#i##@ h%DQ #F ##. # #9#L#I# ##,acl#0#8r#@#HF;##Psrv#\ #` #d F$#hU# ##S##0#É#ĉ##Ɖ#"lj#iȴ# #Rʉ#ˉ#*%##eΉ#ϱ#f$G%#id#۱# ܉# ܉#C݉#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"#-##- #0# 0# <#0#0#0#e0#0#0# 0#i#i# #cap##;#_#o#V@ # # #Jp#sp# # # # q# # #  # `# \# !# _%# $%#  # ` # ] # { %# :  %#  #  # # Y%# # g# 0# n 0# ## ##H "" #|"! #srv""# 4!D #zG#G G# G##R#  #$;#P#( P#,(P#0i#4i#<!px@ #sv#Dw# w# T<0# iidʉ#Eʉ#sidʉ#! #"iidЉ#px@ #buf0#sid0# ptrԉ#bolՉ#H"&4!|Ϋ!! X"E L j" ^"" p"# ,u[v#t0w#t1w#5xF #VyF #z# z{#$|#(#G#len0#pos0# sid0#srv#oe@ #src#bufo ##be@ u# W0#<## srv##? #. #!$Xact"#bck"#,F$act#bck#5%##g #7# ###B #map## H##, !$# A%#m4A%#5A%#A%#A%#A%5%% щ#0҉#5Ӊ#7ԉ# <Չ# ։##׉#؉#*% % % %z yE!&&&)U"( Q#,'v&@RU" ? R$A S%errB&,'V'='()H'*'S'^'+d'V+o'+z'+'(,'_,',','P,'W-'-'~-'g-'&'0:'(.S'j'/ 0fd.'I&_/V.^1uid^11gid^/L^&2m&`'2&a'2;b%0retd2~ d3%3+'3'3 & '4 (h T1fdS#(%R`hU" Q P$S S&(@'(&($+(~(,(~,(V,(P5('6 4( &/V.2;%2~ щ0retщ7*;'gp:U8fdg%lh ~9si 9tj%cfdk~$$l~:9#-޽:"*:#(:<&&;*$;t~$#u~;)%__pS*)*7=)+(0)+(`,+W**+'-+; *%__sP;8*%__sP;P*%__pR*g*7+'D+;*%__pR**7+SV'D+**'<'(&P+'a+'j+**t+'+<̽=j+.+S 0t>0__p.7+31t4P+"/1buf.t .t+h1tg1fg04+1tǐ7-&7@U8s6 "R+6Q$l;8-%arg9W?,ʾ=\R%=R%?,,=\S%=S%*O,-'-+-P'.*r,->A'-+-P'.?,Xe=\`%=`%?,mz=\f%=f%?,=\j%=j%*-.('".&/.('B.'N.'Z.*L-.4C'".&/.4C'B.'N.'Z.*-.O^'".&/.O^'B.'N.'Z.*--'-+-P'.&.'".&/.'B.'N.'Z. - 4.&1s 1bt /&'] @/.i6h@g. -6+6?+u6=,75/%U8s S8reqt V$R+W9p*.5/Sf+F/R+Q/Q*.]/s+j/P? /%__sW*!/v/'/&]/'j/.]/yk/j1nowj4v/+&1buft 4/\&1buft 73&:U8t%s p$M'l$}'0h$T'0W:'if:&lr:%;>0=T<0&3'3?m0$T<0R&3'3*03'3*03F'3'3*03+3R+3V&30+3R+3V*03Sf'3+3S*13x'3'3*C13'3'3<, 4P*Z13'3*13'3'3<, 4P?1~=T<v0*14'"4*1]/'j/*1]/'j/*14(2'"4*'2.4'?4&I4'Z4*Q2d4'u4&4'4*24'4&4'4&4+4P*2t+'+*24'4*25/+F/P+Q/Q*25/+F/P+Q/Q*35/ +F/P+Q/Q&4 '4*P35/0+F/P+Q/V*p35/5L+F/P+Q/V&5/Xs+F/P+Q/V43#1buft 43]'t1bufst .3 u1t1t1t2t44%c1bufbt /7=b02%d04.4%1buft .I4"1t.d4w ~1t}.4u v1tu44]/n\4.41t.41t44%M1bLt A&@RUB4%K 55 >B%L#5)5 ~BB%M#5B$&H5pB&H5BU (oB(tu5)B(uB (vB )Z 5C B*Q5B~+;0Dnow+E?EAE3CtD^AI8SV U 0BGQ:Fp" 'D'E#X'F#f27 2J2G# p z=2J{ --K -- S<.# /. # . # . # .# {.# O.# / .# z.# .#$ `.#( .#, .#0 .#4 ..#8 .#< .#@ .">#D X .#p#F .$#G b.(#H .1#L .7#T +.8#X K.:#\ .<#`7W Qnzd.! .U.#.# .#  z  3tm,w,x#y#oz#w{# ;|#O}#3~#g#~# #$Q#($># ##  ### & wKnK#pK#&z - &#ref!K#4&wd &xb#&y&#&z0# E &{0# %&|0#r&}0#( &~0#T<&0# -&0#$u&#( # F bF# VV #  O+# V# V# bit#u32"09*>+\#key,#Up H0wq1#rq2#. 3#04#450#86k#<N 7#@8#DeeeU N###rP# &#q?N##z2>q40Y  E p#ڛ## *## 7 h '8 H. I0# J0#B K#fd L# T< M0#exp N0#2 Oz #2 Pz #2 Qz # 2 Rz #$ib S #(ob S #, T0#0 U#4t t h   ST< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& #< 7#@ 7#A W#DJ t #L t #P #T #X  X- tstr u#len v#       z &#L &#p e# N#fe "#be "#  # T< #$ 0#(req #,rep #0si $#4a #d" #\ E#srv # # # $#txn #* #W D"# +$#M/ B$# w# w# ## 0#  ] +n! ! #!! #  k A auid^1#gid_#L`&#T buxa [LfdM#. N#O#;P#  QH#KR#+"S#T0#VUN#V&#F'Wd#Xk#f$Yj#Z# [0#mbA #'c#H TQump#+n#o#p#` q# r# s#$1td#(2ud#,Jv#0w#4x#8vy#</z&#@,{#H|&#L[T dT  H /Cf/Ad#b/B # /?cb/C#B/D#. /E7#ev/F7#O /G&#/H# &  h Vh###1J V## #n(* %m&# '#Y(#63)# T<*#-+h#,#V-(# %V%#u%#Z%#len% # %!#A%"#.p 7; 4un 5 in 6EJp 2u 7# 0Q0M#0N#0O#| 0P# ]0;uid0<#gid0=#0>#+"0?# 0@# 0A#0B#*0C#L0D# 0E#$0F#(0G#,'0H#0J0I#4s0I#80J#<0J#@ 0K#D 0K#10Q#x 0RT #c0S#  #a#^##_%#2#`%##a]A#e #j#h#i#i#R#j"+V",#*"-!#R".#{"/Q# ' U) K#&g#aaU B 0# 0#0#*8len*90#cr*:0#V*;0#4 *Cv*D4#( *Ew#*Fw#X'*Gw#0*Hw#  )!!!Q!Q ! !!g!-!D !  ): )l)݉#m_l)މ#u)߉#u_l)߉# v)#v_l)# 8)l)#v_l)#c)#c_l)# r)#r_l)#U)rq)st)@) )0#sol)#eol)#som)0# col)0#sov)0#eoh)0#cap)#sl)8# 4 )W#8)X0)#)# ) #req)U#rsp)U#Xuri)#V )#>)#AE)#T<)0#+) R+)Q#idx)#val)# m)# <THVI#. J# K#hL# M#Z N#O#h%Q"#/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<W&#@Xe#H;ZE#L[E#\;]E#l__#|o`#@b#6b#c# dE#New#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, t"#hu#w0#w0# x0# y<#{0#{0#|0#e|0#}0#~m#x0#4 0#i#i##"h%DQN#F *#*#. # #9#L#IE# A%#,acl&#0&#8r&#@&#HF;_%#Psrv#\ #` #d &#hU# ##S##0#É#ĉ##Ɖ#"lj#i,# #Rʉ#ˉ#*(##eΉ#&#f$'#id#&# ܉# ܉#C݉#0#w0#L0#0# m#m#0#H0#4 0#+"0# 0#70#"*#-*##- #0# 0# <#0#0#0#e0#0#0# 0#i#i# #cap#E#;E#_#o#V"# # #Jp#sp# # # # q# # #  # `# \# !# _# $#  # ` # ] # { '# :  '#  #  # # Y'# # g# 0# n 0# $# $#H+D" (( &#|(! #srv("# "D  #z G#G G#  G# #R #  #$;# P#( P#,( P#0 i#4 i#< l# px "#sv ǂ#D w#  w# T< 0# iid ʉ#E ʉ#sid ʉ# #  Q# # iid Љ#px "#buf 0#sid 0# ptr ԉ#bol Չ# $ & "| l# փ# $  "+$ $B$ t 1$$ ,u[v+#t0w+#t1w+#5x"#Vy"#z# z{#$|#(A%G#len0#pos0# sid0#srv#oe"#src#buf #_%be"u % W0#<&# % srv%#? #. # %XactH$#bckH$#, &act+#bck+# &##g #7# ###B #map%# H%#, %# '#m4'#5'#'#'#'& ' щ#0҉#5Ӊ#7ԉ# <Չ# ։##׉#؉# ' ' "'#4"#u' &# @V(#be'# V(I? +?&# +@&#pol+A# +B0# R++C#'(A(! "&# @#V(# E$# %# %&# '# T<(0# )# *#$O)g#+dow+#h1+#m1+#h2+ #m2+# )+min+i#max+i##+ˉ#"+̉# )+;+*#k+*#)+i+ȉ+O)m"+і)k#+(*+ptr+str+reg+**[#,++&#val+ӻ)#ptr+)##+h# len+ډ#$T<+ۉ#(* +p+i+ll+id+*a+*yE * +"0+i+#ptr+#len+#T<+# ctx+*#+"+kw+Q# ++# 3#+8,# j>+S,# +0# <$+ #+\+j*++" +2,+2, >+ +!&#kw+",#arg+%,# #+&# "+'&#*+S,2,+>,,#+ +&#kw+,# ,+$",+%%str+$+,( X0#len # Q  ,# ,W  ,&i--`U'iԉQ'tmpQ'msg։S(S-)__s*)__s+-0U,b} ,msg}-W-~-p-Q ~QS.7=P/lenU+T.) U,b R,msg-S--V-Q Q,lenW.7=P+.0U,hdrQ,endQV-uQ,lenW0valQR+ /+Q |U,sQP,eQS.t*V.*Q+/=-U-uQ,len ,solQW,idx-R,ctx/0eolQV0sovQS.-p1E0 1*2//3/40 '3050-<6;-50.160-+u0y,;U-uQS,solQ ,idx-,ctx/7#1'#@U,t! S,si!t R,err"-'" -AE"W,msg"#1V20.1KN8;1Q21.13;14G13T1)1 9G1[.~:buf} 9`1#:buf +1161 eU,s5 S-05Q ;1/DpU,strCQp,lenC,l0mE7P0hF1S1 ,;@2(]U,txn\@2P0ptr^Q0end^S<2/7U,s W,sit  0txn@2V0rdr h.V.Q0lenS4273322 383Q3%3473 &3D39 3M,(:s'913##0:ctr/13:inc/0m9P3#!:ctr 13<3A/@nU,s V,sit S. P<5z+pU,s V0pn0fe"~0be"~="0txn@2W.~0uriP0hR.l~0tm~.*5.&;~0hdrS2458-5~895P24P5Vt3a53l52453535*>5(4/__vG>*'/__vF> 5?E5@nowE5@tmJ5 <5x5;(:tv1x5:tv2x5~5 GA5 JP@tv1Ix5@tv2Ix5/retKP<6p/g U,some,idxe- ,capf- f0eolhp0solhl0colhV0sovhW.-ih0hjS0lenkd26/!#3/260GN30B 0__pQ+7+QhU,msg-V-q,QW-. 0S,ptrQR,endQQ-,-)7 1B*1( 1/10I1-y1o-51{**1W(0+8^,*Qp9U,msg'-S-q,'Q -. (0P,ptr(QR,end(QQ-,)W-))7 1*/=1(1,Ep1)N-1r1[1,f1h.o1|.P1/]1*h:9:E(F6E-:lenE:crE9:#"6!-C)e$+<*0TU,t -4"P0txn@2d.*(`. h\=/-.-V0hSDV;80__sW2m;/3/D;h/len2;<3<2;<8'<Q2;3<3@<2;L<3Y<3b<3k<B0msg h9<\&:buf 93<%:buf 9L<+&:buf 9w<&:s :b 6&' +=05 `LU,s4 S,req4 V0txn6 @2W2<=z8=P8=R453535BE5P5)=yk6j:nowj+m>/_ PU,s^ ,req^  0msg` -W.)a PT. %b i@0ctxc X1, (>.X-p 0PB/cr B0hext 0R*:E.t P2>=j~3=8=P26><~3<4m>8~>R8>P4>8>P3>5>!W:nowV6f$V5>A L:nowK6f$K s.- S.(+ V., l=- . ( h.) d0txn @2`., 4W0len P. P4/C`3/+A>+4 U,t3 ,req3  ,exp3 W.@>5 s.-6 l.(+6 V.6(7 h0txn8 @2S0len9 P.9 P4b:MP3o:8z:P8:R+4B. IU,t W,req  ,exp S0txn @2VB 0ret P<'D0 PU,t  ,rtr   0txn @2D0p1 @0p2 S0p3 0p4 .*aS.]*H.-.(+V.,.-. (.S2@C/s3/DhC8.,40valRDCP.,%VDC0__pQDC0__pQ4m>/Q8~>R8>P4>GO8>P3>DD.([VB0__p]QB0__pQ /8~>R8>P4>%-8>P3>D0E(0srvvS*K`=\x%=x%B@0__pZQ8~>R8>P4>8>P3>DG. SDG0srvO .|(P DG 0__p QB8. P+H((0DU,t' P,rtr'  ,exp'.@>)s.-*V.(+*S.,*l=-+. (+h.)+d0txn,@2`.,-4W0len.P..P4/LR3/+I4,P U,t ,rtr  ,exp.@>s.-W.(+V.6(l0txn@2S0lenP.P4b:  3o:8z:P8:R+J.  U,t W,rtr  ,expS0txn@2VBP0retPA3'<2L3<FP3@<2M<(.3'<2,M3<3=3@<(M0es MV./ Q2kM<nt3'<43<tw3@<2M3<3@<2M<cf3'<4<3<9M2*:buf 6( $+/T ./U,s ,req  .-W0txn@20msg-.1"~1. 1)( &1)DN.@V(W./TW=-"DNX0retRB0rdr .w)QRD O0retP2( 1 8~>Q8>P2P>P X 8>P3>2Q>d q 8>P3>D-QP.V.7QV.l*8S2^Q5T?#m#3BT4 3E#K#83R3%3DuQx0qs?PDQ0lenPVB. i0ctx4<$$3<DQ0lenaV0pnbKWDR0len|S0pn}STD*R0__pQ(FR&'.]/SDR .P.(+S4b:x''3o:8z:P8:R(Ry(')0eolS0solV2R/((3/40((30D S8.@V(VBX0retP2+S=L*g*3=8=P2BS<s*y*3<2|Sm>**8~>R8>P4>**8>P3>2S73**3D3(S*+0es MV./ Q2S73++3D32S73,-3D32T<--3<DTp0ctx473./3D3\(9MTD$ L:be K"' cT -;TN0.//U-Q -\S-*A-+W---j/len/.X0/P;OU0A/$0U,px?",l4?  ,l7?R,dir?-1?@+-"@2,Q.X0BP/txnC@2;U2/Y000U-"X2,Q-*AX+S=W/Z;Ua+q00U-Q p\S-*Ap+V--pj;sV,|0I1U,pxz",l4z  ,l7zP,dirz-1?{+-"{2,V/txn}@20ptr~R0lenQ; W*P11U,px",l4  ,l7P,dir-1?+-"2,V/txn@20ptrR0lenQ;W/)12U,px",l4  ,l7R,dir-1?+-"2,V/txn@2/ptr0lenP4W118WQ8WS*11EWR5WR0:sQ:len)i0;|X0+2J2U,px",l4  ,l7R,dir-1?+-"2,Q/txn@2;X^-P22U,px"P,l4 V,l7R,dir-1?+-"2,S/txn@2;Y02F3U,px"P,l4 S,l7R,dir-1?+-"2,V/txn@2*33/__v>;Z1"P33U,px "P,l4  R,l7 P,sol  -1?!+W-"!2,S/txn#@20idx$-Q0ctx%/V;Z@)>4E4U,px<"V,l4< S,l7<Q,dir<-1?=+R-"=2,P/txn?@2;[(QP44U,pxO"V,l4O S,l7OQ,dirO-1?P+R-"P2,P/txnR@2;[.c44U,pxa"P,l4a R,l7aP,sola -1?b+W-"b2,/txnd@20idxe-V0ctxfX0cntgS;2\!,y455U,pxw"V,l4w S,l7wQ,dirw-1?x+R-"x2,P/txnz@2;\-@55U,px"V,l4 S,l7Q,dir-1?+R-"2,P/txn@2;B]*5)6U,px"P,l4 R,l7P,sol -1?+W-"2,V/txn@20idx-Q0ctx/S;]0106u6U,px"V,l4 S,l7Q,dir-1?+R-"2,P/txn@2;6^*66U,px"V,l4 S,l7Q,dir-1?+R-"2,P/txn@2;^L.6$7U,px",l4  ,l7P,dir-1?+-"2,S/txn@20ptrP0endVFb)R07B7UG4,K^^ >G,L_ _ ~GB,M_G$-,_G-,_GGG/tf_G/uG 0Z _H GQ_G~;0InowL?LAL3CtDeAI8SV U 7v-BGQ:Fp" !D!E#X!F# %-{ %- S<&%# /& # & # & # &# {&# O&# / &# z&# &#$ `&#( &#, &]#0 &c#4 .&%#8 &%#< &#@ &"E#D X &#w#F &$i#G b&(y#H &1#L &7#T +&8#X K&:%#\ &<#`  d&]! &U&]#&c# &%#&{ y   3% %$E# ##   ## # 0 w{Wڥ#ۺ# ##+nW  #! #2Eq47Y  p# >    b # .. ~   O #  .#  .# bit %#u32 "79 *> +4#key ,~# n #p # - #ref !#p H 0wq 1#rq 2#. 3%#0 4%#4 57#8 6#<N 7#@ 8%#D64 wd x# y# z7# E {7# % |7#r }7#( ~7#T< 7# - 7#$u 6#( F '8H. I7# J7#BK#fdL%# T<M7#expN7#2O&#2P&#2Q&# 2R&#$ibSu #(obSu #, T7#0U#4  Fu ST<}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#, 7#0 7#4%#8&^ #< >#@>#A^#DJ #L  #P #T #X, X-tstru#lenv%#  u  ^  z #L #p # #fe `#be `#  %# T< %#$ 7#(req u #,rep u #0si x$#4a #d" #\ 6#srv 6# 6# 6# $#txn #* %#W "# $#M/ $# ~# ~# N$# 7#  $ %#J$!%# $"%#V$# # d ] k auid^1#gid_#L`&# buxa  LfdM%#. N%#O%#;P#  Q #KR%#+"S%#T7#VU#V#F'W&#X#f$Y#Z# [7#mb #'c#  TQum,#+n%#o%#p%#` q# r# s%#$1t&#(2u&#,JvL#0wL#4xL#8vyL#</z#@,{%#H|#L  &%% < L% <s'Cf'A&#b'Bu # '?cb'C#B'D#. 'E>#ev'F>#O 'G0#'H# R 9<']'^#)='_#set'`#clr'a# ='b#='c#rem'd#clo'e#1'f# 5'g#$@>'h-#("'i#,C'j#0u'k#4%'l%#8%%%% -!r#8len#97#cr#:7#V#;7# #Cv#D#( #E~##F~#X'#G~#0#H~# 3"QQ  g-D   "p"l"%#m_l"%#u"%#u_l"%# v"%#v_l"%#"l"%#v_l"%#c"%#c_l"%# r"%#r_l"%#"rq"st"p|@" "7#sol"#eol"#som"7# col"7#sov"7#eoh"7#cap"|#sl"# 4 "^#8 "X0"#"r# "{ #req"#rsp"#Xuri"#V "#>"#AE"%#T<"7#s N##%#rW# #  a^#_,#2`,#a+V,#*- #R.%#{/#  A) #&S#MMsAyEfh%D#F ##. %# %#9%#L%#I6# ; #,acl#0#8r#@#HF;Y #Psrv6#\ %#` %#d !#hU# #%#S#%#7#%#%##%#"%#i# #R%#%#*́"##e%#ϲ#f$"#id#۲# %# %#C%#7#w7#L7#7# ##7#H7#4 7#+"7# 7#77#"#-##- %#7# 7# <#7#7#7#e7#7#7# 7#p#p# %#cap%#6#;6#_%#o#V`# ># >#Jw#sw# %# %# %# q%# %# %#  # `# \%# !%# _"# $"#  ~# ` ~# ] ~# { "# :  "#  %#  # %# Y"# %# g%# 7# n 7# # #H B 7# 7#7#>p7;4un5{in66WJp2u7#  #|! #srv"6# 6<T"VI6#. J%# K%#hL%# M%#Z N#O#h%Q`#/R%# S%#$ S%#(+"T7#,6T7#0 U%#4 U%#8V%#<W#@X#H;Z6#L[6#\;]6#l__%#|o`#@b6#6b6#c# d6#Ne~#}f%# g%#;g%#{!h%#r h%#h%#i%#j%#Fk%#idm#n7# n7#o7# p7#q7#ur7#Vr7#gs#, t<#hu6#w7#w7# x7# y<#{7#{7#|7#e|7#}7#~#x7#4 7#p#p#%# ,u[v#t0w#t1w#5x<#Vy<#z%# z{%#$|%#(; G#len7#pos7# sid7#srv6#oe`#src#buf #Y be`u~ W7#<# srv #? %#. %#6 XactB#bckB#,!act#bck#!%#%#g %#7%# %#%#%#B 6#map~ # H #,  # !#m4!#5!#!#!#!6!{" %#0%#5%#7%# <%# %##%#%# *{" " " "{ d#D  %#z G#G G#  G# #R #  #$;# W#( W#,( W#0 p#4 p#<# px `#sv 6#D ~#  ~# T< 7# iid %#E %#sid %##  #N$ iid %#px `#buf 7#sid 7# ptr %#bol %#x$ & d#| # # $F W$ $$  $$+Q+M%#+N%#+O%#| +P%# >&+;uid+<%#gid+=%#+>%#+"+?%# +@%# +A%#+B%#*+C%#L+D%# +E%#$+F%#(+G#,'+H#0J+I%#4s+I%#8+J%#<+J%#@ +K>#D +K>#1+Q$#x +R #c+S%#!&:2L%P77U"3L%S"A2L&Q"2L%R"2L&V#lenL,W"T<LWP$LS%,'2%79U&si p&bu S'2%l'%h(ret%Q(max%d)R' 249h:U&si3 S!(1%p:@U#fd%*si p*bu V*ret%Q*max%l$%h$2%d$1%`+!;++2:?+r ;,<((:;-(-(./(W/(Q0(0 )/)S1T('r2%S,r( )@<d<21)S-:),(D)<<2U)R2`)P3l)<<2})P-)4T=i=(fwd@%R5 ){2h%6bgu 6sig 7fdi%7retj%7maxj%8j%8k%5D)h6tg6fg75l)!W%6nowV%9f$V%5)A L%6nowK%9f$K%))2 @AU&si  S:*2%ArDU&fd%(si W(bu V'%p+!A+r B+2B,N* )AA21)S-:),e**BB-+,*D)BB2U)S2`)P3l)BB2})P-),* )C/C21)S-:)3D)bCwC2U)Q2`)P3l)qCuC2})P-)5+1D%9C%) ,Z2OD(FU&siN V(ibPu W(obQu S(fdR%p,+D)AEZE2U)R2`)P3l)PEXE2})P-),+D)dE}E2U)R2`)P3l)sE{E2})P-)3D)EE2U)R2`)P3l)EE2})P-))<,10FFU&si R(ibu P).-2FHU&si V(obu S'%P+r  G,,*dGgG-+,,D)nGG2U)W2`)P3l)GG2})P-),, )GG21)S-:)3D)0HEH2U)R2`)P3l)?HCH2})P-);$%;-p;%;-;U 'o;'th-s;'u% -< ;(Q{-;~);7;*%;Q7;QR7;U7;j V~; W-;+V$*9]MH3` R0A@p  "0<7 &iBinto 60 >E ?E AE3 Ct D^AI8 SV U  0 - -S<~#/ # #  #  #{#O#/ #z# #$`#(#, #0#4.~#8~#<#@ ">#DX #p#F$ #Gb(#H1#L 7#T+8#XK:~#\<#`  d!  U# # ~#   / 3:Fc" D E# XF#BGQ n #p #  - #ref !#x4w d x# y# z0# E {0# %|0# r}0# ( ~0# T<0# -0#$ ux#(   b#    O### bit~#u32"0?9* >+#key, #p H0wq1#rq2# . 3~#0 4~#4 50#8 6#< N 7#@ 8~#D?)  N# # ~# rP# #]? N]# ]# ) # &#)2>q40Y   p# $ >*#   # *# : q  #  #  q#  w # ۺ#  # # 7 '8 H . I0# J0# B K#fd L~# T< M0#exp N0# 2 O# 2 P# 2 Q# 2 R#$ib S #(ob S #,  T0#0  U#4  S T<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 ~#8 & #< 7#@ 7#A W#D J#L  #P  #T  #X4 X-tstru#lenv~#E E  K   z !# L!# p !# !#fe!#be!# !~# T<!~#$ !0#(req! #,rep! #0si!!#4 a !:# d"!:# \!#srv!# !# !# !'!#txn!# * !~# W!R# !9!# M/!P!# !w# !w# ! # !0#4   ]: +n   # !: # J k} auid ^y#gid _c# L `n# bux aJ   Lfd M~# . N~#  O~# ; P:# Q# K R~# +" S~#  T0# V U#  V# F' W#  X# f$ Y#  Z#  [0# m b} # ' c# T Q u m# + n~#  o~#  p~# ` q# r#  s~#$ 1 t#( 2 u#, J v#0  w#4  x#8 v y#< / z#@ , {~#H  |#L  ~~~  ~CfA#bB #R ?cbCR# BD# . E7#evF7# O Gb# H# b p7;4un5 in6Jp2u7h#'Q 'M~# 'N~# 'O~# | 'P~# 0';uid'<~#gid'=~# '>~# +"'?~# '@~# 'A~# 'B~# *'C~# L'D~# 'E~#$ 'F~#( 'G#, ''H#0 J'I~#4 s'I~#8 'J~#< 'J~#@  'K#D  'K# 1'Q# x 'R # c'S~#c a ^# _%# 2`%#a0+ V,# *-# R.~# {/# n c$8len$90#cr$:0#V$;0#T $Cv$DT# ( $Ew# $Fw# X'$Gw# 0$Hw#  #!!!Q!Q ! !!g!-!D !  #Z#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~#X#l#~#v_l#~#c#~#c_l#~# r#~#r_l#~#u#rq#st# @# #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap# #sl#X# 4 #W#8# X0## ## # #req#u#rsp#u#Xuri## V ## >## AE#~# T<#0# B  0#  0# 0#<TH VI# . J~# K~# hL~# M~# Z N# O# h%Q# /R~# S~#$ S~#( +"T0#, 6T0#0 U~#4 U~#8 V~#< W#@ X#H ;Z#L [#\ ;]#l __~#| o`# @b# 6b# c# d# New# }f~# g~# ;g~# {!h~# r h~# h~# i~# j~# Fk~#idm# n0#  n0# o0# p0# q0# ur0# Vr0# gs# , t# hu# w0# w0# x0# y/# {0# {0# |0# e|0# }0# ~# x0# 4 0# i# i# ~#h%DQ # F # # . ~# ~# 9~# L~# I# V"#,acl#0 #8 r#@ #H F;t"#Psrv#\  ~#` ~#d ##h U# # ~# S# ~# 0# ~# ~# # ~# "~# ic# # R~# ~# *̜$# # e~# ϋ# f$$#id# ۋ# ~# ~# C~# 0# w0# L0# 0# # # 0# H0# 4 0# +"0#  0# 70# "# -# # - ~# 0# 0# /# 0# 0# 0# e0# 0# 0# 0# i# i# ~#cap~# # ;# _~# o# V#  #  # Jp# sp#~#~# ~#q~#~#~# #`#\~#!~#_$#$$# ]#` ]#] ]#{ $#:  $# ~# #~#Y$#~#g~#0#n 0#!#!#HR " " # |"!E #srv""#  D! !~# z!:# G !:# !:# !# R!# !#$ ;#!P#(  !P#, (!P#0 !i#4 !i#<z !px!#sv!ǐ# D!w# !w# T<!0# iid!~# E!~#sid!~# ! !Ͷ# !iid!~#px!#buf!0#sid!0# ptr!~#bol!~#!!&! |!z !֑ '! 9!E -!P!E ?!yE! ,u [v#t0w#t1w# 5x# Vy# z~# z{~#$ |~#(V" :#len0#pos0# sid0#srv#oe#src:#buf #t"beu"  W0# <#" srv"# ? ~# . ~#"Xact]!#bck]!#,#act#bck# $ ~# ~# g ~# 7~# ~# ~# ~# B #map"# H"#, "# $# m4$# 5$# $# $#$ $$  ~# 0~# 5~# 7~# <~# ~# #~# ~#*$ $ $ $ "r%3W~HIU#>3X~$@%r%HI%%&%%'+%(%R)%HH*%$^%%,I1I+%P*%)%IIeI*%,%S -t.-__p,%3/t,%A L~/nowK~0f$K~1%0p "i&g3#~IJU#>3$~2a3%~3s&S3p'W4IJ#3/~V#W3/~p"7'+3gJ LU5tf3php#J3i7'l#O3jS#6'jW3ik~h$&=' K0K+N'P*Y'$ '%iKxK+%P*%6%'KK-lent~&2j}c,e'yk~0j~/nowj~"'WA~L6LU7w3P7|3P23234L*L2\%2%8'&@LLU73S8(3L]MU3pS$((LM*($k((LL*()(LL*)))LL*))-)LM*>))H)LM*Y)))LL+)P)c)M;M+p)Q,("/t,(w ~/t},)u v/tu1')]0n\'),H)/t,c)/t1z)/t9$)9)9):]p:4h:  ~t9t)9u~ *; 9%Q)9~&;0E?EAE3CtD^AI8SV U 0BGQ:Fp" !D!E#X!F# (-{ (- S<)# /) # ) # ) # )# {)# O)# / )# z)# )#$ `)#( )#, )#0 )#4 .)#8 )#< )#@ )">#D X )#p#F )$#G b)(#H )1#L )7#T +)8#X K):#\ )<#` 7 6 B  d)! )U)#)# )#I{B3$># ## 8##8#Hwt6 7# 8#2>q40Yt  p#ڽ#ۊ# ܠ##73 b3#CC  O# C# C# bit#u32"09*>+I#key,#n#p# - #ref!#p H0wq1#rq2#. 3#04#450#86#<N 7#@8#D K4wd x*#y#z0# E {0# %|0#r}0#( ~0#T<0# -0#$uK#([ )'8#H. #I0# #J0#B#K#fd#L# T<#M0#exp#N0#2#O;#2#P;#2#Q;# 2#R;#$ib#S #(ob#S #, #T0#0#U#4 5 5[) #ST< }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4 #8& s #< 7#@ 7#A W#DJ 5#L 5#P  #T #XA X- tstr u#len v#   s   z"#L"#p "#"#fe" #be" # "# T<"#$"0#(req" #,rep" #0si""#4a "#d""#\"#srv"Y#"Y# "Y# ""#txn"#* "#W"!#"##M/"## "w#"w#"׶"#"0# y  ] +n  #! # k auid ^1#gid _#L `&# bux a   Lfd M#. N# O#; P#  Q #K R#+" S# T0#V U# V#F' W%# X#f$ Y+# Z# [0#m b #' c#  T Qu m1#+ n# o# p#` q# r#  s#$1 t%#(2 u%#,J vQ#0 wQ#4 xQ#8v yQ#</ z#@, {#H |#L  % AQ Ax+Cf+A%#b+B # +?cb+C#B+D#. +E7#ev+F7#O +G#+H#W9<+]+^#)=+_#set+`#clr+a# =+b#=+c#rem+d#clo+e#1+f# 5+g+#$@>+h=#("+i+#,C+j+#0u+k#4%+l#8       +  = 1kp7;4un5 in6Jp2u7C#.Q.M#.N#.O#| .P#  .;uid.<#gid.=#.>#+".?# .@# .A#.B#*.C#L.D# .E#$.F#(.G#,'.H#0J.I#4s.I#8.J#<.J#@ .Kk#D .Kk#1.Q#x .R #c.S#^ N###rP# #  a^#_%#2`%#ao+V,#*-#R.#{/#  ,) #&># 8 8^,{ B 0# 0#0#&8len&90#cr&:0#V&;0#  &Cv&D #( &Ew#&Fw#X'&Gw#0&Hw# {V%   Q Q    g - D   %%l%݉#m_l%މ#u%߉#u_l%߉# v%#v_l%#%l%#v_l%#c%#c_l%# r%#r_l%#,%rq%ast%@% %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%#sl%# 4 %W#8h%X0%V#%# % #req%,#rsp%,#Xuri%#V %#>%#AE%#T<%0#+% R+%#idx%#val%# m%# Y<T HV IY#. J# K#h L#  M#Z N# O#h% Q #/ R#  S#$ S#(+" T0#,6 T0#0 U#4 U#8 V#< W#@ X#H; Z#L [#\; ]#l_ _#|o `#@ bY#6 bY# c# d#N ew#} f# g#; g#{! h#r h# h# i# j#F k#id m# n0# n0# o0# p0# q0#u r0#V r0#g s#, t #h uY# w0# w0# x0# y<# {0# {0# |0#e |0# }0# ~D#x 0#4 0# i# i# # h%D Q #F # #. #  #9 #L #I #  $#,acl #0 #8r #@ #HF; 6$#Psrv Y#\ #` #d $#hU # # #S # # 0# É# ĉ# # Ɖ#" lj#i # #R ʉ# ˉ#* ^&# #e Ή# #f$ %#id # # ܉# ܉#C ݉# 0#w 0#L 0# 0# D# D# 0#H 0#4 0#+" 0# 0#7 0#" #- # #- # 0# 0# <# 0# 0# 0#e 0# 0# 0# 0# i# i#  #cap # #; #_ #o #V # k# k#J p#s p#  #  # # q #  #  #  # ` # \ # ! # _ j&# $ j&#  i# ` i# ] i# { p&# : p&#  #  #  # Y &#  # g #  0# n 0#  ##  ##H_! $$ #|$! #srv$"Y# !D" "#z"G#G "G# "G#"#R"#  "#$;#"P#( "P#,("P#0"i#4"i#<C""px" #sv"Y#D"w# "w# T<"0# iid"ʉ#E"ʉ#sid"ʉ#Z" ""#""iid"Љ#px" #buf"0#sid"0# ptr"ԉ#bol"Չ#""&"!|"C""Z""[ # " # 5## , u[ v#t0 w#t1 w#5 x #V y # z# z {#$ |#($  G#len 0#pos 0# sid 0#srv Y#oe #src #buf #6$ be u [$ W 0#< #$ srv $#? #. #Y$X act ##bck ##,$ act #bck #%  # #g #7 #  # # #B Y#map [$# H $#, $# %#m4 %#5 %# %# %# % Y%X&  щ#0 ҉#5 Ӊ#7 ԉ# < Չ# ։## ׉# ؉#*X& d&& & &g#'dow'#h1'#m1'#h2' #m2'#5''min'i#max'i##'ˉ#"'̉#Z'';'Ϡ#k'Р#''i'ȉ'&m"'5'k#'Ґ&''ptr'str'reg'׷'([#,''#val'Z'#ptr'؍'##'0# len'ډ#$T<'ۉ#(U( 'p'i'll'id'U(a'\(yEl(("0'i'#ptr'#len'#T<'# ctx'(#$)"'kw'# 'D)# 3#')# j>')# '0# <$' #>) $ >) +'$)s)  s) )y)) >' '!#kw'"H*#arg'%2*# #'&# "''#l(J)) ) >))#*#' '#kw'#*#2*(!"H*'%#str'$($*-8`M~NU%px &op&totW'V&curYQ'5Yl(*(&maxȉh)H*v͉+#+8LN OU%pxK Q&srvMYR,#+NN-4+-?+.K+Z4:/. 9/'79+n+7hOQOU%pxg R++4z`OOU%srvyYS&p{ V0n6O,#+yO}O-4+-?++,5ONPU%srvYS&p V0n6P,#+OP-4+-?+$,3PPQU%p W&srvYV'?8S&actp&bckl1PP&w`1PP2t3-R6*QRU4srv)YS5p+ W5grp,-P6n6WcR64TSR7-#+QQ-4+-?+7$-#+QQ-4+-?+(<-`8 DYR7X-#+R/R-4+-?+7--RR--,-RR9-P,-RR--#:-7;;s:Y<-]/n\-:-26;sY3z.{5DRSU4sCYV5pE R5grpF-W7H.#+RS-4+-?+7_.-S S--,z./S4S9.S-.:.6=  ;sY>/B4 SFUU4p  V5srvYS?77.#+TT-4+-?+,z.T0U9.W-.3/5PUUU4sYQ2p 5grp-R7s//UU-/)x@/P7//UU-/,/UU-/)@0P:/4z;syY2grp{-:/04j;siY:0V7p;soY2grpq-304dUWU4srvcYS5pe V5grpf-W6n6V64V70#+VV-4+-?+70#+0VCV-4+-?+)8 YP3 26 WYU4srvYW?H6?35p p5grp-l7'1#+LWWW-4+-?+7C1#+WWuW-4+-?+7o1-+X:X--,-+X:X9-PA1X8Y885Q?371-IY`Y--,-IY`Y9-P71-`YoY--,-`YoY9-V,z.oYxY9.S-.3m2B5]YZU4s\YV7Y2m2YY-{2,-YY9-S,2Y Z-2:26J;sIY:26S;sRY335k Z[U4srvjYS5pl V6n6cZ64SZ73#+;Z?Z-4+-?+7 3#+?ZSZ-4+-?+(838 YR7T3#+ZZ-4+-?+73m2ZZ-{2,-ZZ9-P,3Z[-3:37D;sCY3Z4h4[+\U4srvYS5p V6n63[64 \74#+/[3[-4+-?+7.4#+K[`[-4+-?+(F48 YP,2[ \-235<70\]U4srvYS?H6?35p p74#+\\g\-4+-?+74#+g\\-4+-?+742/]2]-2,m2]]-{2,-]]-->57^_U4p V5srvYS?77t5#+^^-4+-?+,2^^-2B 64fY _f`U4pxe 4urieVCme8gPp5phS8+6il86jhB#76Yp`cU4s P8PT5txn#7W5req V5msg)7S5px P860L8)PR5lenPH8+6D5ctxhX5pS)8X-0W1Obb2c)5hex0R1bbjb8P,Bj; 8 cPkU4s 8h7Yp5errV6dDoutc77j;c d-{;9;P(7 5len8W7 8;qee-;9;V-;(7@@;Q@;P1eeE;78;etf-<9<W(J8`@<P@)<\@5<V78N<ef-_<,k<ef-}<,<ef9<P-<)@B<S,<-fRf-<,<-fRf-<1-fRf@<P,<EfPf9<P-<7:=tfh-=9=l(D9@)=W@5=h@A=d@M=V@Y=`Fe=Ei79n=fg-=)@=Q@=R,N<ff-_<,k<ff-}<,<ff9<P-<79=g!g-=)@=PA?:3gqgE=7+:N<3gGg9_<P,k<6gGg-}<,<6gGg9<P-<,/Ygmg-/7[:=ygg-=-=,-gg--,-gg9-P7:=h.i->9>W9#>V)@.>X@9>R@B>T7 ;N<ii-_<,k<ii-}<,<ii9<P-<7O;N>jj9_>W9i>P)@t>S@>L@>V@>H,z.jj9.S-..;5FGsF;GpF;; ; _.;r7zYGpxx /;yGleny*h{0*l{0H*__v0IN<64Y;p3 =73Y2srv5Y?65Y?>6-H2sIY.k< 7-/ 6 I<6<= 5 II<<=Q(C=OB0.<QC-/nB-I=fT<=>S<2tUCIn=7Y;p =7Y2srvY?mY?6Y2grp-?7J3"I=5Y;grp-?>-2sYH?5-:=8;grp-?77 :=7;grp-;sY.N>V5YGpx Guri/mKP*cK5.>45YGpx4 /74YK76K46*srv7YK67YBZ?Z8PklU4s SA?kk2__v>A>kk2__v>1kk2__v>1~ll2__v>AB?~ll2__v>1ll2__v>B?5lWnU4s V5p"P5errSB@3i`ntU4sh W2fdj5errjP(@(8!@p5retS8T<S(H@X8!@l5retS8T<S(`@5msgS7w@@pp-@7@@Wq]q9@Q9@P,@lqtq9 AP-A<@h TGfdS.@!WGnowV/f$V. AA LGnowK/f$KBB7AtwU4t@ S8/5BP6p5X1u7ABu v-B,Buu9%BR-0B7Aj;&v(v-{;-;7A@vv9@R9@P7A@vv9 AP-A,BBvv-OB<BM,(Gs'Y<E?EAE3CtD^AI8SV U 0BGQ:Fe"  D E#X F# #-p #- S<$~# /$ # $ # $ # $# {$# O$# / $# z$# $#$ `$#( $#, $R#0 $X#4 .$~#8 $~#< $#@ $">#D X $#p#F $$^#G b$(n#H $1#L $7#T +$8#X K$:~#\ $<t#`   d$R! $U$R#$X# $~#p n   3 $ >#   # #     # # #  w2>q40Y %a p;#ڏ#0# F## 7    b #  9   O #  #  # bit ~#u32 "0m9 *> +#key ,9#n#p#m - m#ref!#<p H0wq1D#rq2D#. 3~#04~#450#86R#<N 7#@8~#DLLL<4wd x#ym#z0# E {0# %|0#r}0#( ~0#T<0# -0#$u#(  '8H. I0# J0#BK#fdL~# T<M0#expN0#2O#2P#2Q# 2R#$ibS0 #(obS0 #, T0#0U#40 ST<}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0 0#4~#8& #< 7#@7#AW#DJ#L #P% #T+ #X_ X-tstru#lenv~#p p 0 v   zm#Lm#p L# #fe#be# ~# T<~#$0#(req0 #,rep0 #0si"#4a #d"#\a#srv## # "#txn#* ~#W!#"#M/## w#w#׮"#0#_  < ]e +n  #!e # u k auid ^&#gid _#L `# bux au   Lfd M~#. N~# O~#; P#  Q #K R~#+" S~# T0#V U # Vm#F' W # XR#f$ Y # Z# [0#m b #' c# T Qu m #+ n~# o~# p~#` q# r#  s~#$1 t #(2 u #,J v #0 w #4 x #8v y #</ zm#@, {~#H |m#L   ~~ ~  ~  %Cf%A #b%B0 #} %?cb%C}#B%D#. %E7#ev%F7#O %G#%H#  "8len"90#cr":0#V";0## "Cv"D##( "Ew#"Fw#X'"Gw#0"Hw# n!QQ  g-D   !)!l!~#m_l!~#u!~#u_l!~# v!~#v_l!~#'!l!~#v_l!~#c!~#c_l!~# r!~#r_l!~#D!rq!yst!@! !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!#sl!'# 4 !W#8!X0!n#!# !6 #req!D#rsp!D#Xuri!#V !#>!#AE!~#T<!0# N##~#rP# m#X a^#_%#2`%#ag+V,g#*-m#R.~#{/# "s ) #&#yE?h%D #F F#F#. ~# ~#9~#L~#Ia# #,aclm#0m#8rm#@m#HF;#Psrv#\ ~#` ~#d a#hU# #~#S#~#0#~#~##~#"~#ix# #R~#~#* ##e~#m#f$b #id#m# ~# ~#C~#0#w0#L0#0# ?#?#0#H0#4 0#+"0# 0#70#"F#-F##- ~#0# 0# 1#0#0#0#e0#0#0# 0#i#i# ~#cap~#a#;a#_~#o#V# # #Jp#sp# ~# ~# ~# q~# ~# ~#  g# `g# \~# !~# _ # $ #  # ` # ] # {  # :   #  ~#  # ~# Y!# ~# g~# 0# n 0# # #Hv B 0# 0#0#p7 ;4un5< in6aJp2u7v#  m#|!p #srv"# <T"VI#. J~# K~#hL~# M~#Z N#O#h%Q#/R~# S~#$ S~#(+"T0#,6T0#0 U~#4 U~#8V~#<Wm#@XL#H;Za#L[a#\;]a#l__~#|o`#@b#6b#c# da#New#}f~# g~#;g~#{!h~#r h~#h~#i~#j~#Fk~#idm#n0# n0#o0# p0#q0#ur0#Vr0#gsD#, t#hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~?#x0#4 0#i#i#~# ,u[v#t0w#t1w#5x#Vy#z~# z{~#$|~#(<#len0#pos0# sid0#srv#oe#src#buf+ #be u W0#<m# srv#? ~#. ~#<Xact#bck#,aact#bck#P ~#~#g ~#7~# ~#~#~#B #map# H#, <# \ #m4\ #5\ #\ #\ #\ P  ~#0~#5~#7~# <~# ~##~#~#*   ! !6 !D ~#z<#G <# <##R#  #$;#P#( P#,(P#0i#4i#<;"px#svǖ#Dw# w# T<0# iid~#E~#sid~#R" ͘#"iid~#px#buf0#sid0# ptr~#bol~#" &! |;" R" " "p "#p #![#8+~@}m}U"si*Q#[#A}G}$l#P$w#R%#yk~&j~'nowj~(#85p}}U"si4R($8C}=~U"siBQ"msgB$S)#$}}$$R#$}~$$R $ 6 **$[.~'buf}0 ($8T@~~U"siSS"msgS$Q)s$$K~X~$$P)$$X~~+$)$%~~+%)$!%~~$2%Q$=%P#I%~~$Z%P+e%#q%~~+~%*%8'buf0 *!%%'buf0 %I%!W~'nowV~&f$V~%q%A L~'nowK~&f$K~*%#'buf0 ,$#%e,#%,%t%,%u~ %- ,&Q%,~';0,(Q0,Q(R0,(U0,j (V, (W6&D3HCҩ~#9` R0A@p  "0<7 &iBM 5into 60 >E ?E AE3 Ct D^AI8 SV U  0BGQ:Fp" DE#XF# )-{ )- S<*# /* # * # * # *# {*# O*# / *# z*# *#$ `*#( *#, *h#0 *n#4 .*#8 *#< *#@ *">#D X *#p#F *$t#G b*(#H *1#L *7#T +*8#X K*:#\ *<#` 7  d*h! *U*h#*n# *#1{  *  3 \!3!4#!5#!6#!7# !8#!9#!:#N , -#Y .# /# 0N#  $ >#   _# #    _# # #  wtm,w,x#y#oz#w{# ;|#O}#3~#g#~# #$#(2>q40Y  p#_#ۦ# ܼ## ,7 O bO# __ ,  O4# _# _# bit#u32"09*>+e#key,# n #p #7 - #ref !#p H 0wq 1#rq 2#. 3#0 4#4 50#8 6#<N 7#@ 8#D7g4wd x$#y#z0# E {0# %|0#r}0#( ~0#T<0# -0#$ug#( w E '8#H. #I0# #J0#B#K#fd#L# T<#M0#exp#N0#2#OW #2#PW #2#QW # 2#RW #$ib#S #(ob#S #, #T0#0#U#4Q Q wE  #ST<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8& #< 7#@7#AW#DJQ #L Q #P #T #X]  X-tstru#lenv#      z"#L"#p "#"j#fe"#be"# "# T<"#$"0#(req" #,rep" #0si" #4a "#d""#\"#srv"G#"G# "G# " #txn"#* "#W" #" #M/"!# "w#"w#"פ #"0#  $ #J$!# $"#V$# #  ] +n  _#! # * k] auid^1#gid_#L`&#p buxa* wLfdM#. N#O#;P#  Qd#KR#+"S#T0#VUj#V#F'W#X#f$Y#Z# [0#mb] #'c#d TQum#+n#o#p#` q_# rT# s#$1t#(2u#,Jv#0w#4x#8vy#</z#@,{#H|#Lwp p  d+Cf+A#b+B #2 +?cb+C2#B+D#. +E7#ev+F7#O +GB#+HT# B j N###rP# #H a^#_%#2`%#a/+V,/#*-5#R.#{/# ; i) #&{#uui'8len'90#cr':0#V';0# 'Cv'D#( 'Ew#'Fw#X''Gw#0'Hw# \&QQ  g-D   &&l&݉#m_l&މ#u&߉#u_l&߉# v&#v_l&#&l&#v_l&#c&#c_l&# r&#r_l&#2&rq&gst&@& &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&N#sl&# 4 &W#8h&X0&\#&# & #req&2#rsp&2#Xuri&#V &#>&#AE&#T<&0# B 0# 0#0#G<THVIG#. J# K#hL# M#Z N#O#h%Q#/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<W#@X#H;Z#L[#\;]#l__#|o`#@bG#6bG#c# d#New#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, t#huG#w0#w0# x0# y<#{0#{0#|0#e|0#}0#~h#x0#4 0#i#i##h%DQj#F ##. # #9#L#I# N"#,acl#0#8r#@#HF;l"#PsrvG#\ #` #d ##hU# ##S##0#É#ĉ##Ɖ#"lj#i@# #Rʉ#ˉ#* %##eΉ##f$$#id## ܉# ܉#C݉#0#w0#L0#0# h#h#0#H0#4 0#+"0# 0#70#"#-##- #0# 0# <#0#0#0#e0#0#0# 0#i#i# #cap##;#_#o#V# #kw0?%# %=%"& V&###%M&J VM&## #&&,Q,M#,N#,O#| ,P# ',;uid,<#gid,=#,>#+",?# ,@# ,A#,B#*,C#L,D# ,E#$,F#(,G#,',H#0J,I#4s,I#8,J#<,J#@ ,K%'>%&)8(su? ~)@S*('\^%'^%+'P^)^P*('\b%'b%*)#6'\f%'f%*?)>Q'\q%'q%&V)x)r*P*)'\Z%'Z%+'PZ)ZP,)*Ȁ-+.+Ȁ-"+-.+-:+/) gG+P**%2'\%'%*,*:G'\%'%&q*'+".*Oi-+.+Oi-"+-.+-:+,**-+.+-"+-.+-:+,*+Ɂ-"+-.+-:+/)f$0~(resP 0+n1m0G+ -1+1?+N1=,2+99ʂU%msg+$(   3,9fЂU4se 4pxe 4urie %R5repg d5svhG`5svshG\5msgi h&%,69*,YՃ6tM&S7lenu+}8\%8%+}8P6P&,@6P9.,b/p6 "{0P&,6P9,b/6 "0P - 3-}9G .U4sF V4repF W4uriF %7pxH5msgI h5upJ0S,----,--ՙי--.-$--9-O):buf ;-39U:nTP2v.90U%s V%rep W%uri %--*/o8j&X/5pn89 ./>/P*r/Yd7__v>*/7__v>/8jq;/9[:tZ= 1:hU4sg 4repg  ?i 15msgj @Vţ&105es1~,H0---&08896u9~.1`f-11-=1-I1-U1>a1~/`Am1~Ay1Q&05pn15tm.1>1~>1P.--- 1 !B1 :1Cout/+1( /Cerr011R+0Cptr07end27c37 1 -D1Cnow1Ctm1 <E9ҩUF4(K11 >F(L12 ~FB(M1F$)"2pF)"2F+tB2F+uF ,Z s2G FQb2 2GF˜2 2?h%-F~-;0Hnow-GF,V&Hpid,XF,YF,\ F.F.F /FQ0FQR0FS0FT0FU0Fj VF W36/%%b(5GX;` R0A@p  "0<7 &iB 27M 5into 60 >E ?E AE3 Ct D^AI8 SV U  0 B G Q:F: >; 0" !D!E#X!F# )-/ )- S<*# /* # * # * # *# {*# O*# / *# z*# *#$ `*#( *#, *#0 *#4 .*#8 *#< *#@ *">#D X *#p#F *$#G b*(#H *1#L *7$#T +*8$#X K*:#\ *<#`5 7@ :$W c $ d*! *U*#*# *#jc3$># ##" Y##Y#iw6 7# 8#+n  #!#k 2>q 40Y  p#Z## #Z#j7 b#j  Or# # # bit#u32"0!9*>+#key,#FnF#pF#!u - !#ref!F#p H0wq1#rq2#. 3#04#450#86#<N 7$#@8#D u4 wd xK# y!# z0# E {0# % |0#r }0#( ~0#T< 0# - 0#$u #( '8"H. "I0# "J0#B"K$#fd"L# T<"M0#exp"N0#2"O#2"P#2"Q# 2"R#$ib"S #(ob"S #, "T0#0"U$#4   "ST<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0 0#4#8& #< 7#@7#AW#DJ#L #P #T #X X-tstru#lenv# $  $ *   z!#L!#p #0#fe#be# # T<#$0#(req #,rep #0si#4a "#d""#\#srv## # #txn#* #W##M/# ‚#Â#u#0#   ]# auid ^<#gid _&#L `1#6 bux a =  Lfd M#. N# O#; P"#  Q*#K R#+" S# T0#V U0# V!#F' WF# X#f$ YL# Z$# [0#m b# #' c#* T Qu mR#+ n# o# p#` q# r#  s#$1 tF#(2 uF#,J vr#0 wr#4 xr#8v yr#</ z!#@, {#H |!#L= 6 F 6br *b+Cf+AF#b+B # +?cb+C#B+D$#. +E7#ev+F7#O +G#+H#x f N###rP# !#  a^$#_%#2`%#aw+V,#*-#R.#{/:#  4) F#&F# @ @f4%8len%90#cr%:0#V%;0# %Cv%D#( %E#%F#X'%G#0%H# L'$QQ  g-D   $$l$ݔ#m_l$ޔ#u$ߔ#u_l$ߔ# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$#$rq$2st$@$ $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$ڕ#sl$# 4 $W#89$X0$'#$# $ #req$#rsp$#Xuri$#V $#>$#AE$#T<$0#p B 0# 0#0#<THVI#. J# K#hL# M#Z N#O#h%Q#/R# S#$ S#(+"T0#,6T0#0 U#4 U#8V#<W!#@X#H;Z#L[#\;]#l__#|o`#@b#6b#c# d#Ne#}f# g#;g#{!h#r h#h#i#j#Fk#idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, t#hu#w0#w0# x0# yG#{0#{0#|0#e|0#}0#~9#x0#4 0#i#i##ph%DQ0#F ##. # #9#L#I# %#,acl!#0!#8r!#@!#HF;%#Psrv#\ #` #d T&#hU# ##S##0#Ô#Ĕ##Ɣ#"ǔ#i # #Rʔ#˔#*'##eΔ#!#f$U'#id#!# ܔ# ܔ#Cݔ#0#w0#L0#0# 9#9#0#H0#4 0#+"0# 0#70#"#-##- #0# 0# G#0#0#0#e0#0#0# 0#i#i# #cap##;#_#o#V# |$# |$#Jp#sp# # # # q# # #  # `# \# !# _'# $'#  q# ` q# ] q# { '# :  '#  #  # # Y'# # g# 0# n 0# %# %#Hr ## !#|#!$ #srv#"# D #zh#G h# h##R#  #$;#P#( P#,(P#0i#4i#<pxƗ#sv#DȂ# Ȃ# T<0# iidʔ#Eʔ#sidʔ# L#uiidД#pxї#buf0#sid0# ptrԔ#bolՔ# &ˋ |   $   $ < g#'dow'#h1'#m1'#h2' #m2'# 'min'i#max'i##'˔#"'̔# ';'#k'# 'i'Ȕ '< m"'у k#'!'ptr'$str'reg'!l![#,''!#val'Ө #ptr' ##'Q# len'ڔ#$T<'۔#(! 'p'$i'll'id'!a'!yE!$ ""0'i'#ptr'#len'#T<'# ctx'l!#r""'kw':# '"# 3#'%## j>'@## '0# <$' #" E " L !r""  $ $ " #"# >' '!!#kw'"##arg'%## #'&# "''!#!"@# # "+#q##' '!#kw'q### "!"#'%#str'$ "$#acl'* '+!# u',# 1?'-!# '.# '/0##T$I?'> '?!# '@!#pol'A# 'B0# R+'C#|$p7 ;4un5in6$Jp2u7T$#% ,u[vr#t0wr#t1wr#5x#Vy#z# z{#$|#(%h#len0#pos0# sid0#srv#oe#src"#buf #%be u% W0#<!#& srv&#? #. #/&Xact$#bck$#,T&actr#bckr#C'##g #7# ###B #map%# H &#, /&# O'#m4O'#5O'#O'#O'# O' C'' є#0Ҕ#5Ӕ#7Ԕ# <Ք# ֔##ה#ؔ#*' '' ( #B(: -,--#kw-.:#-5k(#k(    B((-=->!#kw-?(#( (!(/Q/M#/N#/O#| /P# /*/;uid/<#gid/=#/>#+"/?# /@# /A#/B#*/C#L/D# /E#$/F#(/G#,'/H#0J/I#4s/I#8/J#</J#@ /K|$#D /K|$#1/Q(#x /R6 #c/S#f*;&$&%!#@&&(#R&'# *; =; >#: ?R#%*h; F x G] ; Hf* T< I]*N; Bop D]#v J*#&@,:n|U'fdmV(T<mS(;m@,(!m@,);oX);pW*retqP);t4d++",__s~$+~ ,~0 ~> '~7,__u~F,,__c~w-Ъ6);*H);*.*__s$R', ,0 > '7,__uL,,__cw++&,v:U(0V(Y (=/;2/:~*fdS*errd*msg:`0,ƬЬ1,2-h T3fdS4H-:(U5 '*R6)0S7err*V8o-c::AU590Q8-q;HPU5G0Q9.;g U:sf$ V:reqf W6h.S69:ip; ..֯<.R<.Q=!.7retR;8..1.;Q..<.P;h..Ұٰ1.0.1 /1/0#/<4/P1?//*>.yk?j3nowj2.83buf 2.\&3buf >#/!W3nowV?f$V>K/A L3nowK?f$K42<;;U5l;5 9 5J95)%:err5=7ptr:l7val0p6;Q+0/<@\%@%+80DQ@\%@%=816Rh6;d7polQ6@(S@.+0l@\%@%+0@\%@%=1(@\%@%.H@P/6P-ݱ@\%@%;Q12<2P;j12E\<2P=1h7acl #P6u:Q;12<2P;12:O<2P;12{<2P;121202 12>#22:?h%142:+@kU:px):l4)$ P:l7)$:dir)51?*"5"*#R43A:?pPU:px=:l4=$ P:l7=$:dir=51?>"5">#6x@p6;@V6 ;@R6A/S/; /;.6_Q66_l6:_h6:_d6:_`A:PUB(L33 BB(M3B$)3B)3B+t 4B+u04CB,Q4Dh%-B-E0B~.;0Enow.S?SAS3C7tDlAI8S7V U7 0BGQ:Fe" %D%E#X%F#  n # p #e - e# ref !#R4$wd $xR#$ye#$z0# E ${0# %$|0#r$}0#( $~0#T<$0# -$0#$u$X#( h  #V##u##Z#># len# ># #!>#A#"#h2Lq40Y  p#$L[# '#[# k '###  w'## ## E 0+n  '#!0# @ k hp7 ;42un5in6Jp2 u7@# b#   O### bit>#u32 "089 *> +# key ,#p H 0 wq 1# rq 2#. 3>#0 4>#4 50#8 6#<N 7#@ 8>#D8 a uid^&# gid_#L`#  buxaL fdM>#. N>#O>#;Pk#  Q #KR>#+"S>#T0#VU#Ve#F'W%#X#f$Y+#Z# [0#mb#'c#  TQum1#+n>#o>#p>#` q'# r# s>#$1t%#(2u%#,JvQ#0wQ#4xQ#8vyQ#</ze#@,{>#H|e#L%>>> A Q> A*Q*M>#*N>#*O>#| *P>#  *; uid*<># gid*=>#*>>#+"*?># *@># *A>#*B>#**C>#L*D># *E>#$*F>#(*G#,'*H#0J*I>#4s*I>#8*J>#<*J>#@ *Kh#D *Kh#1*QW#x *R#c*S># '8&H. &I0# &J0#B&K# fd&L># T<&M0# exp&N0#2&O #2&P #2&Q # 2&R #$ ib&S #( ob&S #, &T0#0&U#4     &ST< }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4 >#8& #< E#@ E#A e#DJ #L #P A#T G#X < X- t str u# len v>#M M  S    z e#L e#p # # fe .# be .#  ># T< >#$ 0#( req #, rep #0 si $#4a k#d" k#\ # srv # # # %# txn #* >#W 4## %#M/ 2%# …# Å# $# 0#< A ' >#J'!># '">#V'#A#  X])8len)90#cr):0#V);0# )C v)D#( )E#)F#X')G#0)H# X3(QQ  g-D   (( l(># m_l(># u(># u_l(># v(># v_l(>#( l(># v_l(># c(># c_l(># r(># r_l(># (rq(>st(@( (0# sol(# eol(# som(0# col(0# sov(0# eoh(0# cap(ڡ# sl(# 4 (e#8E(X0(3#(# ( # req( # rsp( #X uri(#V (#>(#AE(>#T<(0#K N##>#r^# e#P !a!^#!_%#2!`%#!a1 +V ,1#* -7#R .>#{ /E# =k) #&}#wwk ,-! ,-S<->#/- #- # - #  -#{-#O-#/ -#z-# -#$`-#(-#, -_#0-e#4.->#8->#<-#@ -"L#DX -#~#F-$k#Gb-({#H-1#L -7#T+-8#XK-:>#\-<#`d-_! -U-_#-e# ->#( { !  3+C f+A%# b+B # +? cb+C#B+D#. +EE# ev+FE#O +G!#+H# ! 2yE4h%D#F ##. ># >#9>#L>#I#  #, acle#0e#8re#@e#HF; #P srv#\ >#` >#d !#hU# #>#S#>#0#>#>##>#">#iB# #R>#>#*###e>#e#f$ُ"# id#e# ># >#C>#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"#-##- >#0# 0# 1#0#0#0#e0#0#0# 0#w#w# ># cap>##;#_>#o#V.# h# h#J~#s~#>#># >#q>#>#># 1#`1#\>#!>#_#$# #` #] #{ ##:  ## ># #>#Y$##>#g>#0#n 0#J #J #H B 0# 0#0#  e#|!M # srv"# <T"VI#. J># K>#hL># M>#Z N#O#h%Q.#/R># S>#$ S>#(+"T0#,6T0#0 U>#4 U>#8V>#<We#@X#H;Z#L[#\;]#l__>#|o`#@b#6b#c# d#Ne#}f># g>#;g>#{!h>#r h>#h>#i>#j>#Fk># idm#n0# n0#o0# p0#q0#ur0#Vr0#gs#, t#hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~#x0#4 0#w#w#>#J ,u[v# t0w# t1w#5x#Vy#z># z{>#$|>#( <# len0# pos0# sid0# srv# oe.# srck# bufG# be. u ! W0#<e#>!  srv>!#? >#. >#i!X act# bck#,! act# bck#}">#>#g >#7># >#>#>#B # map !# HD!#, i!# "#m4"#5"#"#"#"}"# >#0>#5>#7># <># >##>#># *# $# 4# #D  >#z <#G <#  <# 7#R 7#  7#$;# ^#( ^#,( ^#0 w#4 w#<\$ px .# sv #D ȅ#  ȅ# T< 0# iid >#E ># sid >#s$  ͐#$ iid ># px .# buf 0# sid 0# ptr ># bol ># $ & # | \$ s$ % %M %2%M  !%!m%< U"|M V"S#;&</U$s.M V%txn0;&p%fe1.l&2A&R&6'2A&S'%G&Nj(X&)a&P*%M%h[S+&,ji+%&,jo-6%hUS.k&5F>/sFk&/pFv&q&|&40<>߻U#&<¼U$sM V&7=eQR1>'Z<>мU$sM V$si S%req P%rep Q2>'+(P'(\'34h'P5u' J^6tv1Iu'6tv2Iu'7retK^{'<1(<> OU$sM V$si W''()(P(!(''G& (X&(a&2G&(X&(a&.-(A L>/nowK>8f$K>!(<=PXU9s<M V9si< W:req> p:rep? S'((r((((2(((((;(2*/buf 8( >!f*/<f`U9seM V9sie S'.)>'(P'(\'34h'P'W)>'j(P'(\'34h'P+)P2f*T(s*2}*$*)*Q(*')>'(P'(\'3H4h'P')f*j(s*2}*pv)*R(*'*G&(X&(a&';*>'(P'(\'3h4h'P'R**t(*2*(*;}*M,(/s';*##0/ctr/*/inc/0;*#!/ctr *!*F<QU9sM Q=/&2`U9t1:s3M Vp<}'50l'>&>% ++?T<02/(/++'@X)P'W(\'34h'P'O-0(0'f-0(0'}-0(0*-@?T<0'-0(0'-0(0'-G&fl)X&S)a&P+- :len*>P'*.>'>(P'(\'->4h'P'T.0(020(0'~.0(021(1'."1(312=1(N121)1P'.X1(e1'.o1<?(|1' /1I`)1P)1Q'+/1e|)1P)1Q'K/1)1P)1Q'/o1(|1'/1)1P)1W'/1)1P)1W21)1P)1W-7len>;/#/buf ;0]'t/bufs .-0 u>/t1t>/t2t>;\0%c/bufb 87=b0,%d0@0q<6sM 6si ;0+&/buf ;0%/buf .0"/t.0w ~/t}.1u v/tu;1 ]8n \1.=1/t.X1/t;o1/t;1%M/bL .1yk>8j>/nowj>! 2<PU9sM Q9si P< >P:err>S:fin>RA #%A*VA +w>A*\GA$,K2A,K2A+tk2A+u> 2B A.Q~2A~;0Cnow<<A $Aq/#D (D )exA0>AQ0AQR0AU0Aj VA W1=TNWP<` d8len9d#cr:d#V;d#A CvD#( E#F#X'G#0H# % 3<3PU len3 cr3 :W <3 e%V new3Q intk$O\=` A@p "%<7&^Binto6%>:?:A:3CtDSAI8SV U % 9" DE#XF#f7 [JG[# k9 z=JDBGQ 3#   # #    # z# # " w( 23q4%Y- 8t pN#ڗ#C# Y## ,  -g - S<s# / #  #  # # {# O# / # z# #$ `#( #, #0 #4 .s#8 s#< #@ "3#D X #e#F $#G b(#H 1#L 7#T +8#X K:s#\ <#`d! U## s#t  m  3 b#  `  O# # # bits#u32"%9*>+#key,`#n#p#:p H0wq1k#rq2k#. 3s#04s#45%#86P#<N 7#@8s#DJJJ:4wd xg#y#z%# E {%# %|%#r}%#( ~%#T<%# -%#$u#(  '8H. I%# J%#BK#fdLs# T<M%#expN%#2O#2P#2Q# 2R#$ibS. #(obS. #, T%#0U#4. ST< }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4 s#8& Q #< ,#@ ,#A L#DJ #L #P ] #T c #XE E . K  4 W t ] +n  #! # k auid^#gid_v#L`# buxa  LfdMs#. Ns#Os#;P#  Q #KRs#+"Ss#T%#VU #V#F'W #XP#f$Y #Z# [%#mb #'c# TQum #+ns#os#ps#` q# r# ss#$1t #(2u #,Jv/ #0w/ #4x/ #8vy/ #</z#@,{s#H|#L   ss s  / s  V CfA #bB. #  ?cbC #BD#. E,#evF,#O G #H# 5  9<]^#)=_ #set` #clra # =b #=c #remd #cloe #1f # 5g #$@>h#("i #,Cj #0uk"#4%ls#8 s s s      s   s   Ip7;4un5t in6tbJp2u7!# QMs#Ns#Os#| Ps# ;uids#+"?s# @s# As#Bs#*Cs#LDs# Es#$Fs#(G#,'H#0JIs#4sIs#8Js#<Js#@ KI#D KI#1Qb#x R #cSs#4$=&sUfd% Rdir%sQ 'Phx=+s @Ufd* Pdir*sR=1s@`Ufd0 Pdir0sR=7s`Ufd6 Rdir6sP!ret8sPg 9PH =@sUfd? Pdir?sR!retAsP"( BP#kF=IUfdHsP#{=RUpQ expQsR AESsS!fdTsW!iTsQ Uh o=Vsd =WsV O=WsS!fdsXs` zY_$,{(:%%$H:<%%&c P P'yks(js)nowjs'$s)nows)exps*=soUp V*=**=;*=L*e=] 0=sS#L\=pUp Ss==sUp #=\U!p R+$++@ps  +[r+tV +us , + Q+~;%+V+Q%+QR%+U%+j VkV+ W~k  k =  =Z;IQRO`V>` R0A@p "0<7&iBM5into60>E?EAE3CtD^AI8SV U 0 #-& #-S<$#/$ #$ # $ #  $#{$#O$#/ $#z$# $#$`$#($#, $+#0$1#4.$#8$#<$#@ $">#DX $#p#F$$7#Gb$(G#H$1#L $7#T+$8#XK$:#\$<M#` 7    d$+! $ U$+# $1# $#&G]3 n #p #]  - ]#ref !#:F B G Q" D E# XF#2>q40Y M  p'#$>#  X# #  X# # #w( X# #  2# (#87 [  b [#kk8  O @# k# k# bit #u32 "09 * > +q#key ,#jp H 0wq 1#rq 2# . 3#0  4#4  50#8  6#< N 7#@  8#Dzz zj4w d x# y]# z0# E {0# %|0# r}0# ( ~0# T<0# -0#$ u#(/ '8H . I0# J0# BK#fdL# T<M0#expN0# 2O# 2P# 2Q# 2R#$ibS^ #(obS^ #,  T0#0 U#4  /^ S T<}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0  0#4 #8 &G #< 7#@ 7#A W#D J #L   #P S #T Y #X X-tstru#lenv#  ^  G  z ]# L]# p z#  #fe#be# # T<#$ 0#(req^ #,rep^ #0si#4 a # d"# \#srv# # # #txn# * # W# # M/# w# w# d# 0# M j ] +n   X# ! # k auid^#gid_# L`# buxa  LfdM# . N# O# ;P# Q # KR# +"S# T0# VU # V]# F'W # X# f$Y # Z#  [0# mb # 'c# TQ um# +n# o# p# ` qX# rM# s#$ 1t #( 2u #, Jv%#0 w%#4 x%#8 vy%#< /z]#@ ,{#H |]#L     % L%Cf%A #b%B^ # %?cb%C# B%D# . %E7#ev%F7# O %G# %HM#+c  N# # # rP# ]#X a ^# _%# 2`%#a%+ V,# *-# R.# {/# c X ) # &#  1 B  0#  0# 0#Yp7;4cun5j in6rJp2u71# 8len 90#cr :0#V ;0# Cv D# ( Ew#  Fw# X' Gw# 0 Hw# rM   Q Q    g - D   l݉#m_lމ#u߉#u_l߉# v#v_l#l#v_l#c#c_l# r#r_l##rqXst@ 0#sol#eol#som0# col0#sov0#eoh0#capڻ#sl# 4 W#8_ X0M# # d #req##rsp##Xuri# V # ># AE# T<0#<TH VI# . J# K# hL# M# Z N# O# h%Q# /R# S#$ S#( +"T0#, 6T0#0 U#4 U#8 V#< W]#@ Xz#H ;Z#L [#\ ;]#l __#| o`# @b# 6b# c# d# New# }f# g# ;g# {!h# r h# h# i# j# Fk#idm# n0#  n0# o0# p0# q0# ur0# Vr0# gs# , t# hu# w0# w0# x0# y# {0# {0# |0# e|0# }0# ~# x0# 4 0# i# i# #_h%DQ  # F 2# 2# . # # 9# L# I#  #,acl]#0 ]#8 r]#@ ]#H F; #Psrv#\  #` #d !#h U# # # S# # 0# É# ĉ# # Ɖ# "lj# iȹ# # Rʉ# ˉ# * ## # eΉ# ]# f$ٍ"#id# ]# ܉# ܉# C݉# 0# w0# L0# 0# # # 0# H0# 4 0# +"0#  0# 70# "2# -2# # - # 0# 0# # 0# 0# 0# e0# 0# 0# 0# i# i# #cap# # ;# _# o# V#  Y#  Y# Jp# sp### #q### #`#\#!#_##$## #` #] #{ ##:  ## # ##Y.###g#0#n 0#H #H #H @   ]# |! #srv"# zD # z# G # # # R# #$ ;#P#(  P#, (P#0 i#4 i#<pxƆ#sv# Dw# w# T<0# iidʉ# Eʉ#sidʉ#  ͈#diidЉ#pxц#buf0#sid0# ptrԉ#bolՉ#&z|/    H ,u [v@#t0w@#t1w@# 5x# Vy# z# z{#$ |#(  #len0#pos0# sid0#srv#oe#src#bufY # beu !  W0# <]##d #I?!?]#!@]#pol!A#!B0#R+!C#>##g#!dow!#h1!#m1!#h2! #m2!#B$!min!i#max!i##!ˉ#"!̉#g$! ;!2# k!2#$!i!ȉ!#m"!B$k#!ҝ#$!ptr!str!reg!$X+%[#,! !]#val!g$#ptr!ؚ$# #!# len!ډ#$ T<!ۉ#(b% !p!i!ll!id!b%a!i%yEy%%"0!i!#ptr!#len!# T<!# ctx!+%#1&"!kw!#!Q&#3#!&#j>!&# !0#<$! #K&  K& $1&&   & &&& >!!!]#kw!"U'#arg!%?'# #!&#"!']#y%W&& & K&&0'#!!]#kw!0'#?'%!"U'!%#str!$%$'acl!*!+]#u!,#1?!-]#  !.#!/0#'?!3!4]#acl!5'#neg!6# ['!(_?!9!:]#`>!;]#%I(u#1?I(#Y(&(@;`vU'px9'l49  'l79'dir9(1?:&(":&P&/)@AFU'pxD'l4D  'l7D'dirD(1?E&("E&P&)>SU'pxQ'l4Q  'l7Q'dirQ(1?R&("R&P))@_U(Q ^(*A^K& (-^ )M*>fU'pxd'l4d  'l7d'dird(1?e&("e&)*?lU("k&(*AkK& )*SAscU("r&S(*ArK&Q*W/t)++?p"U("&V(*AK&P+>S,ret-"+?S)l+@0U("&S(*AK&Q*W/)+w?U("&P(*AK&V*W/)3,aAU("&S(*AK& *W/ȉ.endW.cS/,@ +ӉR-OR*Ӊ&,@U("&W(*AK&R(|(s+f>l+W/h.cW.endd.psV.plS/,X 0 1p 2 P3&-> 6U4"&P4*AK&R3_- ?'@VU4"&&P4*A&K&R3-2A-`U4",&4*A,K& 3-R?5U4"4&R4*A4K&Q5s6-R239.?C=U4Q BS4*ABK&W4-B 6lenD7`.6?O@IU8ptrO3.p>VPU4Q UP4*AUK&V4-U 2*W$S2W/XP30?vU4Q uV4*AuK& 4-u 5iwiVW5jx0Q2X'x0p2px0l5ptryS9/  0\}%0}%-  0P}2}P9/$@0\~%0~%-$@0P~2~P/+0 0\%0%1 0P2P/m0 0\%0%1 0P2P-0\%0%-0P2P32?.U4Q V4*AK& 4- 5iih5j0V2X'0d2p0`5ptrW91J`0\%0%-J`0P2P91d|0\%0%-d|0P2P/2 0\%0%1!0P2P/Y2!0\%0%10!0P2P-0\%0%-0P2P32*> 0[U4Q P4*AK&P4- :3@,`~U8kwl+3P':N3b@4U8kwl33P1H!0j533E>='U4u<W4<V5acl>'S-0\@%0@%3 4@JU'U8kwI0K2?LP5kwlM3W704%A^U8pat]K&S;4Ar&AU41?q&W<4=4->4P>4V?4>k@j6patlK&6tmplK&35?&PU4l;VA?uA(?A!A21?&\2>U'X2*AK&S2-`2>W5argT/5`!6end0@-`5retR35>'cU8acl'21?&S2>&V-2=0j3~6z@'pPU4l;V4I@WA?A>A@2 A'R2 >&S2uV367@7'P@U4n?6W4I@6 A?^4A>[!A@Y2 A9'R2 >:&S2u;V2<V-p0\?%0?%37C?d#@U4@c#2C@e7W2@e7p2@>f7P2oAf7S''38S@v#RU4l;u4I@u 8poluPA?A:@A7>5argx`5negxW2@yV2 Az'\2>{7S2@|7X2@}#T-g0\%0%-g0P2P39@`U4@#P8px 8l4 8l78dirA@*2C@72@>721?&S5acl'P2*AK&W2"y%22@2A2=-6__s33:>S';U4@R#P4>R0V2C@T7S2@>U7R5aclV'PB~>u@OUC4"KS:Y: >C"Lk:q: ~CB"Mk:C$#:C#:C%t:LC%u:DC&Q::: 0E=; :+>.'d.;.; !(F?F; ;2S#h'8dK%U PA` R0Aint@p "0<7&wBo60>S?SAS3C7tDlAI8S7V U7 0BGQ:Fe" DE#XF# n# p#e - e# ref!#R4wd xR#ye#z0# E {0# %|0#r}0#( ~0#T<0# -0#$uX#( h n 2Lq40Ys ~ p#$L# ##  @##@# P w#ۉ# ܟ## E  -C - S<># / #  #  # # {# O# / # z# #$ `#( #, #0 #4 .>#8 >#< #@ "L#D X #~#F $#G b(#H 1#L 7#T +8#X K:>#\ <#`d! U## >#J  C  3   b #  6   O #  #  # bit >#u32 "0j9 *> +# key ,6#p H 0 wq 1A# rq 2A#. 3>#0 4>#4 50#8 6#<N 7#@ 8>#Dj'8H. I0# J0#BK# fdL># T<M0# expN0#2O#2P#2Q# 2R#$ ibS0 #( obS0 #, T0#0U#40 ST< }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4 >#8&  #< E#@ E#A e#DJ #L #P % #T + #X_ X- t str u# len v>#p p 0 v    z e#L e#p # # fe X# be X#  ># T< >#$ 0#( req 0 #, rep 0 #0 si `#4a #d" #\ P# srv # # # p# txn \#* >#W # #M/ # …# Å# 6# 0#_  < ]e +n  #!e # u k a uid^&# gid_#L`# buxau  L fdM>#. N>#O>#;P #  Q #KR>#+"S>#T0#VU #Ve#F'W #X#f$Y #Z# [0#mb #'c# TQum #+n>#o>#p>#` q# r# s>#$1t #(2u #,Jv #0w #4x #8vy #</ze#@,{>#H|e#L   >> >  >  C fA # bB0 #} ? cbC}#BD#. EE# evFE#O G#H#  p7;4un5< in6PJp2 u7#' N##>#r^# e#k a^#_%#2`%#a8+V,#*-#R.>#{/h# v k) #&#'L"8len"90#cr":0#V";0# "C v"D#( "E#"F#X'"G#0"H#  !   Q Q    g - D   !J! l!># m_l!># u!># u_l!># v!># v_l!>#! l!># v_l!># c!># c_l!># r!># r_l!>#!rq!st!JV@! !0# sol!# eol!# som!0# col!0# sov!0# eoh!0# cap!V# sl!# 4 !e#8!X0!#!L# !6 # req!# rsp!#X uri!#V !#>!#AE!>#T<!0#1 B 0# 0#0#<THVI#. J># K>#hL># M>#Z N#O#h%QX#/R># S>#$ S>#(+"T0#,6T0#0 U>#4 U>#8V>#<We#@X#H;ZP#L[P#\;]P#l__>#|o`#@b#6b#c# dP#Ne#}f># g>#;g>#{!h>#r h>#h>#i>#j>#Fk># idm#n0# n0#o0# p0#q0#ur0#Vr0#gsA#, t^#hu#w0#w0# x0# y1#{0#{0#|0#e|0#}0#~#x0#4 0#w#w#>#1Xh%DQ #F ##. ># >#9>#L>#IP#  #, acle#0e#8re#@e#HF; #P srv#\ >#` >#d e!#hU# #>#S#>#0#>#>##>#">#i# #R>#>#*"##e>#e#f$f"# id#e# ># >#C>#0#w0#L0#0# ##0#H0#4 0#+"0# 0#70#"#-##- >#0# 0# 1#0#0#0#e0#0#0# 0#w#w# ># cap>#P#;P#_>#o#VX# # #J~#s~# ># ># ># q># ># >#  # `# \># !># _"# $"#  2# ` 2# ] 2# { "# :  "#  >#  # ># Y## ># g># 0# n 0# ! # ! #H   e#| !p # srv "# LD  >#z <#G <#  <# 7#R 7#  7#$;# ^#( ^#,( ^#0 w#4 w#< px X# sv #D ȅ#  ȅ# T< 0# iid >#E ># sid >#  ͐#6 iid ># px X# buf 0# sid 0# ptr ># bol >#` & L|   p dp vp yE! ,u[v# t0w# t1w#5x^#Vy^#z># z{>#$|>#( <# len0# pos0# sid0# srv# oeX# src # buf+ # beXu W0#<e#!  srv!#? >#. >#@!X act# bck#,e! act# bck#T">#>#g >#7># >#>#>#B # map # H!#, @!# `"#m4`"#5`"#`"#`"#`"T"" >#0>#5>#7># <># >##>#>#*" " # #6 !#xA2PU"u"( 0V"T<0#A2S#D2R#Q(W$ 0%#AVU#D2S&B#'R#VV! $AU`U"AT2S'retVP(K$AjU"Ai2V#'kP#VkS!$AQU"A2S)x!$j($A` U#D2S#E ^V#^W#A>p*$$*$*$*t %*u> 0%+ *#Q%#Aed2W A` A@p <7&SBint3CztDHAI8SzV Uz %"  D E#X F# $ 36#   # 6# F  -Q - S<h# / #  #  # # {# O# / # z# #$ `#( #, "#0 (#4 .h#8 h#< o#@ "3#D X #Z#F $.#G b(>#H 1#L 7#T +8#X K:h#\ <D#` d"! U"#(# h#Q >  T 3"'8H. I%# J%#BK# fdLh# T<M%# expN%#2O4#2P4#2Q4# 2R4#$ ibS#( obS#, T%#0U#4..T" ST< }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4 h#8& #< ,#@ ,#A A#DJ .#L .#P #T #X:  ]hhC fA# bB#_ ? cbC_#BD#. E,# evF,#O Go#H# o   B %# %#%#B % oUctrR[!%VB!%Qage"%P\f,6uA B-%a,%b,%A:%pUctr9SB9%V 9%[;%QB;%Rage<%P,6SAX%UctrWSBW%  W%[Y%QBY%RCZ%ageZ%P,6$`F`tuh  Q :%!now <bX"~ ]B` Aint@p <7BAI b#k y  O# # # bit3# B U >W Z+!R 8: 8:+7 TLOf OR+7 skn Tf +7 's @TfQs vss B>BNB%MB%B%BB jB DTB,BDtagO Jy3sB3,B2B tagO |B~UsubnewV ~AW!R&2 .sCCP Z + qs #!Q TILfR QS+7 s\_skn_zBsubnew)BDB_B_;B_ PX'!OB3 WfZj%B` Aint@p <7BAI b#k y  O# # # bit3# u32"% s32#3 ;9* >+#key,#oBoU unewo .{4p!VlShTf"&2"&P_ "TW?  NBo unewooldoOB%,B"C>C DBB ;B B! DBF BF ;BG CG!"ret]N #TBu$,B%tag &y&3#2B$ %tag &#8C 3%x 3"r 3#+CoNU unewo #5pAq8"MVYleSqh}dTEHf`"TWP"#)Co$ u%newo"oldo OB% ,B "C3 >C DB B ;B B! DB B ;B C!"retN~B#oPU "uPx"Vj~QS'"SPRTfifB{o zuxz>|o,B}y~HB(obU 'uPx'V4HYd'"mSxPWRTfBo ux>o,Bkeyy3 C1op%U 0uPx0W>2o(,B3VTf3APM3APM)N$Q($OB%f\ 0IC` A@p <7&SB2,int3CtDHAI %:3;% -w -S<s#/ # #  #  #{#O#/ #z# #$`#(#, #0#4.s#8s#<z#@ "3#DX #Z#F$#Gb(#H1#L 7#T+8#XK:s#\<#` d!  U# # s#~  w  3 $ 3&#   # &# 6 q4% 6g  pA#5'8 H . I%# J%# B K# fd Ls# T< M%# exp N%# 2 OG# 2 PG# 2 QG# 2 RG#$ ib S#( ob S#,  T%#0  U#4AAg5  S T< }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#, %#0  %#4  s#8 & #< ,#@  ,#A A#D J A#L  A#P  #T #XM  ]ss C f A# b B#r ? cb Cr# B D# . E,# ev F,# O G#  H#  ;= ;>L# :?#h;FxG;HT<IN; B opD# vJ#XC"s0U;#hfd$sP#__s&Su&,&%&3'&,__u&__c&aK$ t us  Q]D|wC` A@p "%<7&^Binto6%>:?:A:3CtDSAI % 0C"fd#s# D$l# oC%l#f7 RJ GR# b0 z=J;BGQ 3#   # #     #  z#  #  w 23q4%Y$ /k  pE# ڎ# :#  P# # ,  -^ -S<s#/ # #  #  #{#O#/ #z# #$`#(#, #0#4.s#8s#<#@ "3#DX #e#F$#Gb(#H1#L 7#T+8#XK:s#\<#`d!  U# # s#k  d  3 b#  W O### bits#u32"%9* >+ #key,W#n#p#1p H0wq1b#rq2b# . 3s#0 4s#4 5%#8 6G#< N 7#@ 8s#DAAA14w d x^# y# z%# E {%# %|%# r}%# ( ~%# T<%# -%#$ u#(  '8H . I%# J%# BK#fdLs# T<M%#expN%# 2O# 2P# 2Q# 2R#$ibS% #(obS% #,  T%#0 U#4% S T<}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0  %#4 s#8 &H #< ,#@ ,#A L#D J#L  #P T #T Z #X< < % B  + N k ] +n   # ! # k auid^#gid_m# L`x# buxa  LfdMs# . Ns# Os# ;P# Q # KRs# +"Ss# T%# VU # V# F'W # XG# f$Y # Z#  [%# mb # 'c# TQ um # +ns# os# ps# ` q# r# ss#$ 1t #( 2u #, Jv& #0 w& #4 x& #8 vy& #< /z#@ ,{s#H |#L   ss s  & s  M CfA #bB% #  ?cbC # BD# . E,#evF,# O G # H# ,  9<] ^# )=_ #set` #clra # =b # =c #remd #cloe # 1f # 5g#$ @>h#( "i#, Cj#0 uk#4 %ls#8 s s s      s  s   @p7;4un5k in6kYJp2u7# Q Ms# Ns# Os# | Ps# ;uids# +"?s# @s# As# Bs# *Cs# LDs# Es#$ Fs#( G#, 'H#0 JIs#4 sIs#8 Js#< Js#@  K@#D  K@# 1QY# x R # cSs#+$=)sUfd( Rdir(sQ *P_x=.sUfd- Pdir-sR=4s Ufd3 Pdir3sR=:s UUfd9 Rdir9sP!ret;sP'@ <P? =Cs`UfdB PdirBsR!retDsP"# EP#bF=LUfdK P#{=UUpT expTs AEVsp!fdWsS CWsl CXsS!fdsZsh zZsV!sr[sP!sw[sR!rn\%d!wn\%P$0{%%$L%%&c0# P P'yks(js)nowjs'$s)nows)exps=sUp V*=e*=v*CLJ 0=sS#A\=Up Sh==sUp #=|U!p R+$++@ps  +[r+tM +us , + Q+~ ;%+V+Q%+QR%+U%+j V`M+ Wsb  b =y  D _ nD` A@p "%<7&^Binto6%>:?:A:3CtDSAI % BGQ 3O#   # O# _   # z# #  w 23q4%C;LY  p#H## #H# X,  -c - S<s# / #  #  # # {# O# / # z# #$ `#( #, :#0 @#4 .s#8 s#< #@ "3#D X #e#F $F#G b(V#H 1#L 7#T +8#X K:s#\ <\#` d:! U:#@# s#c V  l 3 b#  l  Ot# # # bits#u32"%#9*>+#key,#HnH#pH##p H0wq1#rq2#. 3s#04s#45%#86#<N 7#@8s#DN~4wd x#y##z%# E {%# %|%#r}%#( ~%#T<%# -%#$u~#(  \'8 H. I%# J%#B K#fd Ls# T< M%#exp N%#2 On#2 Pn#2 Qn# 2 Rn#$ib S#(ob S#, T%#0 U#4hh\  ST< }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4 s#8& #< ,#@ ,#A L#DJ h#L h#P #T #Xt   ], +n  #!, # < ko auid^#gid_#L`# buxa<  LfdMs#. Ns#Os#;P_#  Qv #KRs#+"Ss#T%#VU| #V##F'W #X#f$Y #Z# [%#mbo #'c#v TQum #+ns#os#ps#` q# r# ss#$1t #(2u #,Jv #0w #4x #8vy #</z##@,{s#H|##L   ss s  sv   CfA #bB#D  ?cbCD #BD#. E,#evF,#O GT #H# T &9 9<]^#)=_S #set`S #clraS # =bS #=cS #remde #cloee #1f # 5g #$@>h #("i #,Cj #0uk#4%ls#8N sN s s9 e N Y | | sZ k  s|   |   p7;4&un5 in6 Jp2u7 #2QMs#Ns#Os#| Ps# x;uids#+"?s# @s# As#Bs#*Cs#LDs# Es#$Fs#(G#,'H#0JIs#4sIs#8Js#<Js#@ K #D K #1Q #x R #cSs#>ptr:fd;su32<u64=C 7D8#>x#>D)D*%#fd+%#8C!sU ( !sS!!Sm$=TsU"fdSN Q"dirSs #EDfU$ofsg!.DhsQ!DisS!VisR%chgjsp%fdjsW&q'S("(,'6V)|*AS+MVD"s, D"s-op"s-fd"s,C"M."/CU"fdN Q CsS%ptrRx=seU"fdN p"dirs %ofsV!DS!CRP=spU"fdN p"dirs %ofsV!DS!CR/F=U"fdsW%ofsüS/%D kU"fdsV%ptrӐP/=p@U"p| "expsS.AEs%fdsd!zsp!Csl0N'S'Q(()*W0j ((&"$((+C#s, D#s,D#M,D#s,f$#s.#+yks,js-nowjs+$s-nows-exps1=s@mU2p| V3}D23`D43D6'3C883D;S40=sS5\=Ep U2pD| S1==^s ( U2p]| 6fd_sP1Cos0 \ U2pn| 55=~`  U6p| R7$BX7B7@ps rZ 7[rb7t 7us 8 7Q7~;%7V27Q%7QR%7U%7j V 7 W!D.s0!C/,!D0W(!=:n4!D=M8!5D>s<%evC@ s !Cbdb D` A@p "%<7&^Binto6%>:?:A:3CtDSAI % BGQ 3O#   # O# _   # z# #  w 23q4%C;LY  p#H## #H# X,  -c - S<s# / #  #  # # {# O# / # z# #$ `#( #, :#0 @#4 .s#8 s#< #@ "3#D X #e#F $F#G b(V#H 1#L 7#T +8#X K:s#\ <\#` d:! U:#@# s#c V  l 3 b#  l  Ot# # # bits#u32"%#9*>+#key,#HnH#pH##p H0wq1#rq2#. 3s#04s#45%#86#<N 7#@8s#DN~4wd x#y##z%# E {%# %|%#r}%#( ~%#T<%# -%#$u~#(  \'8 H. I%# J%#B K#fd Ls# T< M%#exp N%#2 On#2 Pn#2 Qn# 2 Rn#$ib S#(ob S#, T%#0 U#4hh\  ST< }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4 s#8& #< ,#@ ,#A L#DJ h#L h#P #T #Xt   ], +n  #!, # < ko auid^#gid_#L`# buxa<  LfdMs#. Ns#Os#;P_#  Qv #KRs#+"Ss#T%#VU| #V##F'W #X#f$Y #Z# [%#mbo #'c#v TQum #+ns#os#ps#` q# r# ss#$1t #(2u #,Jv #0w #4x #8vy #</z##@,{s#H|##L   ss s  sv   CfA #bB#D  ?cbCD #BD#. E,#evF,#O GT #H# T &9 9<]^#)=_S #set`S #clraS # =bS #=cS #remde #cloee #1f # 5g #$@>h #("i #,Cj #0uk#4%ls#8N sN s s9 e N Y | | sZ k  s|   |   p7;4&un5 in6 Jp2u7 #2QMs#Ns#Os#| Ps# x;uids#+"?s# @s# As#Bs#*Cs#LDs# Es#$Fs#(G#,'H#0JIs#4sIs#8Js#<Js#@ K #D K #1Q #x R #cSs#>ptr:fd;su32<u64=C 7D8#>x#>Ee%#s1%#6CDs ' U( DsS DS!YD0 z U"fdN S!SE  U"fdsS#pos%V$=s  U"fdN P"dirsQ#retsPx=s  U"fdN S"dirs $EZ #i%P%e=s  U&fdN S&dirs 'E (i%R)F=%  U&fd$sS)%D/ ? U&fd.sS)a=8@ U&p7| &exp7sp*1E9%`*D:%d*AE;sl(eo;sS(fd<sT*.D<sQ*z=sh*D>sd*C?sW*)E@s`'D'V +P#*6(NsW,a  -rS-}Q../  0\+p#(esR,-S...1,0S,H'..249.0.;3CFs4 DFs4DF4DFs4f$Fs5F3VDEs4 DEs6opEs6fdEs4CE5E3yks4js6nowjs3G$s6nows6exps%=1sU&p0| S'DKD'EMV'COg'DR)\=\U&p[| S%==qs HU&pp| (fdrsP%"CsP}U&p| )F=U(p| R7$SX7S7@ps Z 7[rs7t 7us 8 7Q7~;%7V27Q%7QR%7U%7j V7 W/ DsT Ds\ HEsX DyL EP% Dh 5Dsl#evpKeJ .EintAI@p <7&dB3C/tDYA6  -G -S<!#/ # #  #  #{#O#/ #z# #$`#(#, #0#4.!#8!#<y#@ "D#DX #k#F$#Gb(#H1#L 7#T+8#XK:!#\<#` d!  U# # !#N 6 G 6 3EI!EJ(EMdENREyEtE  $fEElowE#oEE#CPsNllOEP$9Eg.UnfVWdfPQ'9$MKU_#judtpVRWlhWPQ# RPbfP#EUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Em1m0 C!$;!;\Rg0EintAI@p <7&dB3C/tDYA6  -G -S<!#/ # #  #  #{#O#/ #z# #$`#(#, #0#4.!#8!#<y#@ "D#DX #k#F$#Gb(#H1#L 7#T+8#XK:!#\<#` d!  U# # !#N 6 G 6 3EI!EJ(EMdENREyEtE  $fEElowE#oEE#CPsNllOEP$JE[0UuZvZPQw\pJ8;\fpl#{`VW\DRPPXT8#P'LƁɁP4EUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: E!m1m0"C#$L#L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I! : ;" : ;# : ;I$.? : ; @ %.? : ; ' @ &: ; I ': ; I (.? : ;' @ ): ;I *4: ;I + U,: ;I -4: ;I .4: ;I/ U0111213.? : ;' I 4: ;I54: ;I61 7.: ; ' I 8: ; I9.: ; ' :: ; I;.: ;' @ <.? : ;@ =.? : ;' I@ >4: ; I? < ?!@4: ;I? < A4: ; I? < B4: ; I?  C4: ; I?  D4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I  : ; % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #: ; I $4: ; I %4: ; I & '4: ; I( : ; ) U*1+1,1- ..? : ;' I /: ;I0 : ;14: ;I2 : ;3 : ;I44: ;I 51 6.? : ;' I@ 7: ;I 8 U941 :.: ; ' I ;: ; I<: ;I =4: ;I >41?.: ;' I @: ;IA4: ;IB C4: ; I? < D4: ; I?  E4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( ".? : ; ' @ #: ; I $%4: ; I&4: ; I '1(1 ).: ;' *: ;I+.? : ; ' I@ ,4: ; I - .: ; I / U0 14: ;I 213.: ; ' I 4: ; I5.? : ;' @ 6: ;I 74: ;I 8194: ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' @ ": ; I #1$1%.: ; ' I &: ; I'.: ; ' (: ; I).? : ; ' I@ *: ; I + U,4: ; I -4: ; I .1/1 0 141 2.: ;' I 3: ;I44: ;I5.? : ; I@ 6 74: ; I84: ; I? < 9!:4: ; I? < ;4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; ' @ : ; I : ; I 4: ; I  4: ; I.? : ; I@ .? : ; @ 4: ; I.? : ; ' I@ 4: ; I !.? : ; I@ "4: ; I? < #4: ; I?  $!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #: ; I $4: ; I % &4: ; I ' U(4: ; I)4: ; I* +4: ; I? < ,4: ; I?  -!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I! : ;" : ;# : ;I$!I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I<4: ;I =.: ;@ >4: ;I?.: ; ' @1 A.: ;' I B: ;IC : ;D.? : ;' @ E4: ; I? < F!G4: ;I? < H4: ; I?  I4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #4: ; I? < $!%4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.: ; ' @ ": ; I #1$1%1&.: ; ' I ': ; I(.: ; ' I@ )4: ; I *4: ; I + U,1 -: ; I.4: ; I/4: ; I0.: ;' @ 1: ;I 24: ;I 34: ;I 4.: ;' I@ 5 : ;6 U7 84: ;I94: ;I:.? : ;' I@ ; <.: ; ' =.? : ;I@ >41?41 @ A4: ; I? < B!C4: ; I? < D4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #4: ; I $ %4: ; I&.? : ; I@ '.? : ; ' @ (4: ; I)4: ; I *1+1,1-1 ..: ; ' I /: ; I0: ; I 1 U24: ; I? < 3!44: ; I? < 54: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ;' @ ": ;I #.: ;' I@ $4: ;I %4: ;I &1'1( U)41*1+1 ,41 - 1..: ; ' I /: ; I04: ; I1: ; I24: ; I3 : ; 4.: ; ' 5.: ;' I 6: ;I7.? : ;' I@ 8: ;I 94: ;I: : ;; U< =4: ;I> ? @.? : ;' I A.: ;' @ B4: ; I? < C!D4: ; I? < E4: ; I % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( " : ;# : ;I$!I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F.: ;' @ G4: ; I? < H!I4: ; I? < J4: ;I?  K4: ; I?  L4: ; I M4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I < !.? : ; ' I@ ": ; I #: ; I $4: ; I %.: ;' I@ &: ;I '4: ;I (4: ;I ).? : ;' @ *4: ; I + : ;,1-1. U/41 0411 U21 314 5.: ; ' I 6: ; I74: ; I84: ; I9: ; I:.? : ;' I@ ;4: ; I? < $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( ".? : ; ' I@ #4: ; I $1%41& U' U(41 )1*1+1 ,.: ; ' I -4: ; I. /: ; I0: ; I1.: ; ' 24: ; I34: ; I 4 5: ; I 6 7: ; I 8.? : ; ' @ 94: ; I? < :4: ; I?  ;!<4: ; I? < =4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I3.: ;' @ 4: ;I 54: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH I.: ;' I J : ;K4: ; IL.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!.? : ; ' I@ ": ; I #1$1 %.: ; ' I &: ; I': ; I(.? : ; ' @ )1*.: ; ' +1,4: ; I? < -!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!< "!I#.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; < !.? : ;' @ ": ;I #.? : ; ' @ $: ; I %4: ; I &4: ; I '1(1)1 * + U,4: ; I- ..: ; ' I /: ; I0.? : ; I@ 1.? : ; ' I@ 213 U441 5.: ;' I 6: ;I74: ;I8: ; I9: ;I :4: ;I ;.: ; ' <4: ;I =.? : ;' I@ > : ;?4: ;I@.: ;' A4: ; I? < B!C4: ; I? < D4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $1%1& '.: ; ' I (: ; I): ; I* : ; +4: ; I? < ,!% : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !.? : ; ' I@ ": ; I #4: ; I $4: ; I%.? : ; @ & '4: ; I (.? : ; ' @ ) U*4: ; I? < +!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $1%1& U'.: ; ' I (: ; I): ; I* : ; +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? <   src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdlib.htask.heb32tree.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hdd9,V # +9,VV9,VV9,V\Ve%9^a;dEI#jc =G9+V0co>l 9x3xA̎WVVVVUrVGr<:t q՜hȎWr ՠIdVH,KX|:f.ds*~ Ȃ~MGsuOf,9T9,9T{ c&9V*9V9*9Vk(9X9(9XzkkUTnU 9^DSsGI&d8H~c@999H cU"G2yG~c~+~93xG~c~+~9@c~+~9Ve9+~UVUrwUV~9 + wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWrddWƸ~.7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae9U:V✀v-7;zGJ8dd,d+t<7e5=D-8Vz9W=scW)-b Ȏq9.ɯn=5=+nU  ;%urrVg ׀8Hdh  8rr0˪V-rsU s csU+rd5 ($V8:VXYXWW~ V^<d32R<RYU9U#rpq'1q~9xU gVU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.hpHTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.hGHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊh srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.h0Ud8,J:,1|8,YJJ:1n8,fe$f͓8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8,, src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h;|t*:V*,:eU,I;,qs{>>V: fsU *rey2GdT԰GYԸV< 9 R,dW:W;G;*s,5/G<*t,z91%"Lz9>:d8,J&rG f6dqJ:*J:8dede9 9W/ctGwӏuUWHs~G*:5rU)t4 9t+0Vrhd*: 5/~:U@y9>l?rqd++rcHsVrxncre cƒ+,cV qw3W<ude ~+~+:~+9~9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.hd8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӑ5gd;6d*GnX<;)-a;,HVVW,t #z+fm;)-a;,HVVW,rc%#z+<`>jXr;)-a;,HVVW,t oc:8HY5hdnf%V;,sHzU c, ye,H srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hfd.hglobal.htime.h0uŪ~|<:;juŪ~<,;iG R<:;XRh@XRh9 tq9c">T:;)Wcfn:drwJ,S,Wuc(:pH rT#~9T(\x9#W2-4Ӡ:Ss:s;aH#;hEUdU 7Wŷ<8:iEG;cEc9d(yP E srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.h`G GfU9aG@y+@ GVeuA%GdS;Td;tr*d,fwq>qQ=:`G,+hUzG?|G+ Gk+~U=zU9+h+zG?}Ge9+sY*GVobqdTdV,Wed8++\ 9~=zG9qxqz?G|98f99/cW7Q/9WrԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+"od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:m2 src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cstddef.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h0$q:r7XG U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV j src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,9/ src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hstat.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hgrp.hcfgparse.hacl.hstat.hstdio.hlibio.hctype.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h@0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@Us/L#*&TI* $:p: c7,:;`;V8db s+\qH st-fr.GJ##Ic|qՆ(*r=~qՆd~ՆxqI%*r=ov  GG GGNe70b9fb9ge@dcd(eZH7ddrGHg5g6<6Xae-bd,.d9#*:e8|#*~,8dzE99ycz9c,*:,d64cPd &9)-sI~Ixs %#*un+*z-$*:f6f7d,8d8:VHL wUbd.n9$*:,(}s 9*+,xr,H, GH#*&TI* $d v+zqI<-N,czdc#*W oqmIHzHxsrr$ cv+yrq G G GH tq, GH,~&dcWyH|tH#*^1&*t +tck+ rdHr  GN#* cy9=`V;=5fV7rd cw9 c8,sc s+9 q~cr9~&sU tU ciM圡Vqd9y+}\-dr8r1rIstx~-vd9~$# #r q-dde U:8;7:HxrI#*b,dVI#*b,dVcHxrHxrI#*b,dVH#*LbHxr HzrxqrdsI#*8,&WX*8,h&WrrI#*b,h&WWHjV5yHxrI#*dswrI#*b,h&W[b,h&WVrrI#*8,&WWHj5yHxr#*L=*llUclcl+9*,X~ 99rxqr H+=GpG=z9rvcq*8,v,$u,dsyqd *8,ldbeS<8dl@9c* -Yrv,"7rvn:Ảz9P8U~$e7`e)e b;+L'IIZbrp/L;~d GԜ:|N"Unq?F:drf(`0d9{YYUN  t+e~\ xUAzde*,v M, 7-=mf9 $%x9k w9 +,,: G5uRr\k+ 9d)edTd cH8, 'f6f_ee+'pdeaff`gd|9~d Gf#_U~WGeU$Ugq9 Xdaday *~9IIg8r8d_= csc~f8,=T98,=cWeGd~d~@y9g9g#hUR:dgGUgU}WfGfU9}Ws7fU1d.db+:@9:8,j srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeserver.cserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.hmemory.hbuffers.htime.hstdio.hlibio.hfd.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hr9;HfĜ9;X{  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includechecks.cproxy.htask.hqueue.hticks.hfd.hacl.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hqueue.hserver.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hfd.hstandard.htime.hglobal.hs0q,qcc, as:;7ecs9 9s9GV9*+V9*+b9tG +t9+'<\:(I;7ecs9 9s9Gt9 tc c,0=5.6<6=7e cx9itn0t(@ 7;sEe,ptq, +18HFM 8faWdgK@y9vtn0t(@IpN:=1 9w9dtn0t+9If ndVǢHs ,:r}c*G}G,N+4GL+6GGRHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d l  srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hfd.hglobal.hstandard.htime.hsession.h9:iEas,Sd=cc~'$#sv, G~,~qVUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zq<D%Vq 9t+ cK~HM1>yq~+ )#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`G{:n+qIł|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcyqO92+N+4+L+1yN+6Gc9~zdH-,8: zcdH-,8:,pyY+~=qyqyqczqzqƜ x>9B9nf99c8V1c7sO197e:}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd   srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hfd.hglobal.htask.hselect.h`G",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6:7/JU,k}qr:T:krRGI7-v::8e :rt:/V8:a:[r8k>rV%+8d~I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎W:vqe 9vUd ~+:b:;7:,`:b:;7:,iwUA+$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^!Gy+ %z_S9-9S+-9 9_ 9_ +_c+hq U6f_q Vi8rV8;8:8dqUA+l 4'4dpUdjnUY*Gcopcp95c,6rsƀd ӎ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrkmY*G~c+~++vGE +c7-UmqRd`c`Uq`9G`99H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrjlvq qm?z9iUiqFq:9q9 V;#:p+HZ,@y+@y9@ ;8pe7H=53x9<Tld28,.78;, wU5=g*Z}s 9s9: qV;V:jyc@yG Vd[<6/540l=e:8eaX++t+;7db 9t+ 9'xq 9z9dcc?d9d+9dqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5չ+=6< iz9r;7=5;d6<,zyGd q9UdJ7;a#ƀ qcdc cd cccdq %qc9qUqGp]dW);oV q%3rr8    cwG p9UdHdb:r pcdc cd cccdqH8:ib:Vd pcdc cc cdcqd8d8:;  :!9"#$pŜU@y9jn<<6mrssH9Uqn:*dvG} +9n+9n+W}c}G?;:6rrV|qbr:db*;7,b;7-T d~bK8bea,:}$::8:e7,8:dKӝ\ƀ pcdc cc cdcq~1{ X DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W9dV\c$_qPU  srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hfd.hstandard.htime.hglobal.hproto_http.htask.h`MPAh cv9 9v+ Śft)rrc~f9ecn[*dd;m9+x~?z9.ԜhG:IGHdHw rtc + :8,H:8 9w+dp@(deU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95dVr8;lU6;HddH40P GǙfrrdpVsy92vU=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f|GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:Z9&9H8,8:^>:8:Up9t ;I7; 9 +t9 +w,V:=C/:0,=5)4 VH:T1:*ru8:8: 2:0Sq&$5=G9:TqvG<6ffJfrn?7sz+i{chczG?|G +d|~U=zG9+xqzG?G|+G}U?zcsժgrrvr}h+z?|G+e mc+I:::9q;:{U9h+z?GIb.c9Km++HG:bd*dH,8 c{c8dcz99H :8wthŪD9 d*dH,8{dsvȜ XwHVrgw+T}3Hw9{qhcz}U% *u-rss:4}0v+=;d8J<:pg5=,;+.3,*}>(\ 9;,8p-K T̎*#fU7s#:4 I <G **J(~:pl03;d*I,8<&,bd9>,* }9Gq~G~cg+c+( ~{clis#/dK|+|Uq}';sdȓ97*}cq}B-G0zc?H+@4> +*ed Gd q:*}0+|9}}lish ϒ$izd Gzd G+UgIGԀ*V+*f++9qGHR:6<~nsxw+~cV '$ 8'$ 0 3v' U#'>8zwwzzwzzP=<Gw=<Pe7bd~:b,+s&67e,Ɯ:Vu9 9u9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dw vc +O>g= m <9,+ 9krI+v9 qd  srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hfd.h standard.hcfgparse.htime.hglobal.h task.h)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#,~qVUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#ӏ)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~q  9D}]u!GN4vpI:p 7-TIX  ū;7;6=b:8:b?|&8:8&:WW&|Ub,9UkU*A᠎|q8:8F:|8:8:8'|:*9d0(:p-V q=,::7VV Ursf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzcdH-,8:xdH-,8:,p{rdT:Vrsb~~q9z%W+e6} qxu{qJy=:LGr c}h9Ǝ8rd-H?:?zzGGr~bdrds{3r}dԀdŎe}H  <dy:*dcf)w>9B9 n f99b 8V1c7s O197e:cx+|dqY*GdUY*GhY*G_:qY*GdUY*GhY*j~HkH~Vkez?wqx6qq6|qc#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.hselect.h%9::8:-J:8:-JG;#HII7;HI<b+:x usU 9 f *Zcry+@y+Ax+,8:G-zc1s>XLPYMX)T,T,4d8))pUrr2P>8dtXX RGx*srT:ddS-  `.Wgrtrrrrrrrrrp srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hfd.hstandard.h`:9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.h cU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.hyqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h0!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.hselect.hpoll.h(9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud*I:FjGf9j9 c8,*y98:)WWS;|;);YWl9fP>TfEt6XJX R Gz*srT:dƸdS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.h G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;Hrtzc?HXdpJp ~G,#_as@d-rrcw~qfG~q *G P>pdWJ6XX8VJ8YRGu*s[,GHWƸdzq439.*IV d8We c `.grtrrrrsrrr{ srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.htask.hmemory.h G,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9r*:7W+,V Ӓ ;aW)7W=7N+՜|4f9 q/R<bbc"~+W;S/; 7W,}9c}UG+eVeVV@p+&:T}f9}9 T9`Gqcq>ae6XJ8YRGfGr,fq!rT:dơdl59.*IV d8We U `.grtrrrrsrrr. /var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/bitslibgcc2.clibgcc2.hstdio.hlibio.htypes.h}7:;.IKqU~q,lUH qS~r՜UqW)-7;T;V8,-I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8. '.. .). >.$` .pih  b.. 5..4.. .*.{..0.. 0.. ..  ..  .. ..0. K.g. .. ..  .. Z.M. .&. }.6. .*. .. J.5. .X. !.>. 7.. 0. . .. %.2. *.W. !.. .. .V. .. .. .g. {.X. v._. *.. +.. .7. p.'. <. . !.|. M.9. .. . . 5.. .. '.Y. <.. I.. '.. (.. *.2. *.i. c.;. '.m. #.. '.. <.i. <.i. <.m. '.U. '.e. '.. '.. '.. ?.B. '.. .. '.H. <.m. '.j. '.K. C.`. 0.+..o..o. A.N. J.\.  .. ..  .ha  '...G . -.. .. .r r | 4r: 40sR | 4sj !.8. 0t 8.4t 7.` u E..D. Q.0.U.N.  .`v7 ..D. Q.0.-.S.,. X yL ..D. \.?.6.  .Tpz- ..D. \.'.6. L{ ?... .[.<}h W. -..0 . .=.g.p.I..^.. .R... .. 8T g..| (!@ $!(  .!} 8! .:.8!_  ..,! .| 8L"` . ".tL"   .?. H.. .B. ..0#..C. L"0J L"S ,L"| ?.,L"`{ ?.L" $L" .| # 7 #`* T# .... @.. .D#Y a.Y. .B. T# <.5.... .0#Чz ".l#PJ R........(..L#  _...=..H#@ .%. ... ,# .,#S .<# [..d.|#Ю5 .J. ...  . . ... )..t#g  .2. ... 3.l....  .$# .| H(Q pH(R  . K.........<H(`  ?...0H(p  U.0H(@ .0H(  =.0H(: A.$H(@ .| 4(*`9 ..0(*t  .0(* c .0(* /.((* \ 8(* ^..4(*+ . . 0(*@ .$(* E ((*pa ((* <(*  .n.3.X(*@. 0.....2..D(*p  E.. .. 0(*  .((* ((*p D(*@ .S.:./. 0(*0$ .8(*` . .8(*P R. ..0(* .4(* %. .<(*  . Z.. L(* b. .. 8..0(* Z.X(*Pz .. .. L.. -.0(* I.X(*t  .0. .&. .. .<(*0 . .. L(*P [. n.. 5.3.0(*  U.<(*  E. &.*. (*@   G...Q. .. 9.M. . . .. .=. .|.g. 8(*  ..I.. R./. J.P... =.d. .O. \.N. q.-.V.u. ..F. L.?.d.q. *.n.. L.. u..q... v.R. 5.$.. <(*/\  ..&.(*/D ,(*00o =.,(*0A  .((*0Y ((*P1O ((*1e (*2: ,(*P2s 5.,(*2v 5.0(*P3 *. ,(*4E ;.,(*P4? 5.0(*4_ -. ,(*4E ;.,(*@5? 5.8(*5 *. ^.,(*06E ;.,(*6? 5.((*6d $(*07 .| (7P7C D77L M. {..H.,79x I.<7p:w . w.1.,7@ 8.D7A E.Z.L.n.07D 1.$70Fj '.07F .| $9H .<9I) %..P.09JJ .$9L& .$9@LM ,9L .| (:`M :N :OA (:`Or (:On <:PP0 ...0:QA $.0:R x.0:S u.(:PU (:U" L: W  . .{.'.r.,:Yc %.,: Z .4:[ . .D:0\ $. .B.0.,:^ .8: _F  ..<:p` . 0..T: c0 2..h.4.?.*.,:Pkt O.,:l c.:`n  .x. .g. @.. 1.=.&. L./. #.d. ..=.[.0:t* <.: w; 0:`w0 .0:z 5.0:0{ 5.0:| 5.0:| 5.$: } .| A@}- Ap}* ,A} .,A@~ .| 0DB~  R.$DB .HDBЂC  .n. ..0.v. ...y. ..@..0.X. ..PI. _. 0. ./. D.8. ...5.. ..@..7.@1. L.C.P... LDB  ..`J.5. .<DB0e 5..` .,DB9 .DB . '.\. '.T. Z.p. D.!. -. .;. B.?. #.. D.XDB   .). s..0+..@.$DB .| <E f. .S. LE  O.F. v... 0ET .EQ EPQ 0E[ m. hE+ .. X.K. .9. =.[. .E@+ (Ep $EP6 .| ,H{ _.8H ..$H? #.(H 0HмC .0H /  .0HP }.LH`v .6.s..t.Hq H`t ....$.I."..*.U.Q..2.I. .s. .H. .$Hp | (JP |  K$  K    K@  $ K`5 $ K0  K$ 8 K . ., K ., KpL  . K   K | L` L0 L L  L  L ,Lc ,.4Lp *. +.,L0X !.,Le &.0L [.0L\ .$L  .$L@ .(L`m L) 0L=  .$L@  .,LPd  .(L4 (L. $L0+ .L` L 0L@ .0L .,LL .0La <.<LP .X..<Lc ./. .<Lp  .k. .<LP !.. .0L@h +.0L .8L` . .(L; $L@ .| 0|SP M.,|SV $.8|S`\ .#. .,|S4 .,|SQ  .<|S` .R.0D. | (T O (TpF $TS | (dU  (dU | 0U_ .0Un .(UP{ (U (Up | 8V0 .1. .|  W$  W   W  $ W 5 $ W`0  W$ 0 W+ ., W "., W@  . W   W | $X' X" (X ,X? (XU (XpX (XN (X K 0Xp .,X@- H.,Xp .$X ( .,X0 ,  . .X`  | $L[ ' ,L[0 J ,L[ P L[ 2 (L[ t (L[ c ,L[  .$L[  DL[@ O ..Q.B.,L[  K.,L[t  .$L[ ( .,L[P-  . .L[ | (] | (^0 totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavailsrc/haproxy.c__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconndo_logre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_addcookie_strprev_ctrhash_listfailed_secualgo__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlennb_taskswmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqcurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdgraceHTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbnext_svidpool2_requrinow_msnbbeuri_len_limituri_dirs_depth1node_p__socklen_texpb__task_unlink_rqcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectnb_req_capHTTP_METH_DELETEcum_sessdata_stateHTTP_METH_PUTeb32_deletebeconn_maxniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_t_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addfbcktv_acceptHTTP_METH_HEAD/data/git/public/haproxy-1.3/branch/masterto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnprotocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyusagefastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrfe_maxspstimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_task__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitpx_id_markersfwlcs_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tlogssrv_addrredispatchesrequest_counthandlerhttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basedisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headl_lingerloglev1loglev2mon_fail_cond_old_offsetuser_lenconn_retriescallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognamedowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freeshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authstats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_nameout_realmstats_add_scopestats_check_init_uri_authstats_set_realm__lenout_base64ulistnew_nameout_ubase64src/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sunout_nofree__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_nameh_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstrl2llrcret_valomultidivstr2sastrlcpy2octetshextabstrl2icinvalid_domainchar__strl2uicunit_flagslimit_rescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_string__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlennbloggerslogfdunixmonthnametm_zoneget_log_levelget_log_facilitysend_loglogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzinit_tasktimerseb32_firstrqueuenb_tasks_curprocess_runnable_tasksmax_processedeb32_nextsrc/task.ceb_nexttick_is_lttick_is_expiredrqueue_tickseb_first__task_wakeupwake_expired_taskseb_walk_downrun_queue_cur__task_queue__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifset__tv_isgtmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollernbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_inithex2src/regex.c__resrm_sopmatchcheck_replace_stringregoff_told_dstregmatch_tchain_regexrm_eomatchesexp_replacehex1cfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listproxy_type_strst_sizeatoist_blksizepw_passwdcurproxyconfsectst_gidrangeproxy_reset_timeoutscfg_keywordnext_pxid__s1cfg_optsdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidacl_seenwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoscfgerrcfg_parse_globalinit_default_instancerportparsest_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkpw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4__statbufha_usererrnumsrv_downtimesrc/server.csrv_getinterpc_bcktick_addattemptstask_newprocess_chkfd_insertout_wakeuppc_endevent_srv_chk_rpendconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledsrv_was_pausedset_server_enabledstart_checksout_errorcheck_for_pendingset_server_upout_nowakeredistribute_pendingset_server_downmininterevent_srv_chk_wlskerrsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrc/queue.cpendconn_get_next_sessprocess_srv_queueratioinit_pendconnsrv_dynamic_maxconnpendconn_addpendconn_freependconn_from_srvget_frt_addripv4out_fail_repacl_fetch_dstacl_fetch_dportout_fail_idxacl_testsalensrc/client.cmax_setbuffer_initpatternsacl_keywordout_fail_rspcapout_free_sessionmin_setfreeptrbufupdate_freq_ctrfetchout_closeout_fail_reqcapacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskladdracl_fetch_dconnmax_acceptacl_fetch_sportout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosemaintain_proxiestick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwarduxst_unbind_listenerserr_returnbuffer_check_timeoutsuxst_req_analyser_statsdestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_reqcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenersuxst_add_listenerbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxhttp_msg_oodhttp_msg_rpbefore_crdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdrbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookielocal_asessionpathlenquotedhttp_msg_rpline_eolacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverasession_tempstats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenret_ptrhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptrhttp_is_tokenauthenticatedhttp_find_header2http_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirecthttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spmaxlenHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionnext_hdracl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcodeacl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrhttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupappsession_refreshinitializedhtblelementses_msizeidlenappsession_initkey1key2appsess_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsconnect_serverstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_errprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queuemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treeold_statefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_rateget_server_ph_postfwlc_get_next_serversrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeupdate_backend_weightiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serversstream_int_report_errorsrc/stream_interface.cstream_int_retnclosestream_int_returnbuffer_abortstream_int_check_timeoutssection_typesv_statesrc/dumpstats.cultoaprint_csv_headercurpxsrv_hlt_ststats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_update_stream_intsess_set_term_flagssess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafter_do_poll__fd_cond_cfail_srevt__fd_is_setfd_set_bytes_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_set__fd_clrsrc/ev_select.cfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwendacl_match_domdefault_acl_listout_free_expracl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_stracl_match_subtmp_termcreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventold_evtepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevt__fd_cloopcodeepoll_fdfd_chgfd_flush_changesepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncespec_processednbspecfail_fd_listspec_idxspec_listfail_specswitch_stateloopinglast_skippedfd_statusfd_createdrelease_spec_entryDWstructhighlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01:\c^ h W  >     58;Cru~x{C^Lk"PSYx1;Oc?IMPSYPSY_4ctvORq,_oU\w#13<Tdfm<p$&(2G^4v8ft\fGr8@@G   < }   4 & 7 < ? 16AV G1QToQq riQq3(6C6465 QT<o=o<o=oT P! ??A??88,-r,,+,((''e!E#% &&>& &&k&'&&tvcrmr(****+C68-f2,,,r,./O8800.../x34ZS[Y5ZWYYiXX$XNX <:<;;:z;=>; <|;;~ArDtDOCDFF%EgEDDE%EDDE%EGGII4HHLHLMMLLMjMLM"N|NjMMM"NO5PH]]Q>SPQIUjUSSS5WWSS d@dccbmcSS]^W$XSBUjU5WXWYYY)^^=`z`4_R_^^g[geuf^+_R__+_4_[ggfg_4`z``4`=`higAh`zad4eab4ee4bbc dmccUddeeiivllj>kijYlvl>kkkYlllmmp@pqnnmqnppn(o=op@ppcqcrXsssQsqqqqqqrsstw0y_{z{Syz`yqz_{zzt{φpCdži&Ȅ\{_|l|+V>~φpdžvnnVCni eflD  ! ?  JLO>jPF H`sK` '`sfy; dg ` *v m m ev d , /J  #   & }W r  d}   ! % v$+15qv~y~ $ +!%: W x U a M O @ L o    Q W *`sV[n7OY|     "s""&$))))T***j0+-H0j0/ 0z//k..,,z// ,",,,//-V.//Y.k.-.//..../ 0191Z2m21/2232273J334(4;4 4}55:;}55;;5566::66=77::7$8x99O8x9O;;=::9:;';=::::???$@@@@@@@A$EKFM@FCF8E>FAdCF*GKFF@FCFE>F2BCKFF}NObbqaaY``Z_a_[\ZZY @` 44P}_- h "6xXt  # @ D F P w +-1G` GSs#G[&6sMSb[!{"?''&8&%%3%T%{"~"&'8&K&%& %3%*$P$"%#~""&&T%%**++**++*+- -, -,,%'/"[}SV=P %+ik}SVCP _ =!##j 1o x 1 R s x y #jW 3| j#p U#t#"#| "####$ %(*7%O(p%Y')#*'O(['g'p%v%)#*'O(%$'%%%%y%|%()#**  $+0wy} [  0 : 0 : 0 :  O p 2;>@kps{ 7 = ]  p F ! &  L e y h r w9DZ$1en &x(369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r !)V)V '_e'Kip+v#+>>5D,.%W\_'*p  ,PVH@=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh$7 `? @Go,,To@c 888l pp u00%pXX{D44`` \F\xVxtV<(W(0W04W4WXlY ex  QeY] cCL) h-#5 9E X^F0 EQ W $ e 5'l dL -4Hh,8p 0 X  4 `\FxVV(W0W4WWXYe !"#$%&' (/ >I/  V(W0WYe@ p $W!,W.V<0WH >^/4 ee[ eЩ5  [ +6en;Pf@JP\\\h\p`fy`j|jjjjj @2 \@  j@ '` =jDFjQZcsj tt t  u v7  yL pz- { }h \S )0J 7| E`{ U e s{t] Y  ]TR ` @ D^&/\ 5/D D00o S0A a0Y qP1O 1e 2: P2s 2v 4E 4E 06E P4? @5? 6? .6d =aK@ ]pa l zP3 4_ 5 07 7L  )b3z C0{ W| n| N OA `Or On QA R U" $ W >PU KYc _ Z {[ 0\  } {b~ bb  " c. @+ @ p {PcV + h cTt T cT 4d P6    $    @   `5 0  $ "  + 4  = pL F   O  \ 8db ` q  0 d \ @  L a @  d     #  $       5 `0  $ " + 4  = @ F   O  / : (B ,K 0U d` ' " 4m  ~ @  < ? U pX  N K " p 84 @- = p F ( 0 , O `   L P T X \` ' 0 J  P 2  t c     `( d" @ O l h~ p 4   = t F ( P- O  9 H dO dU  e   v " " D< k  /  !H /  `# #8 $! $2 d> ,F / S <| e  x \ > ,\ @  F !O P!] !\  "2 @"0 0p" ?8>t M@ YA fTB }/T ::Tv tU! / ~ / ~ /~ /~ ~F /  Y@= ,PP0 < NC ` w; l c f h @ `M jp}*   `\`(-8C ; @  Jd Ua5 rP2 xe0 H@. H ;@ t1 ж / :P I[xdP u@h `\ Y;  e h' .@LM 6/H4WQp `tjj ~`v @  @ @}- t p5 0 j (S 4I) D=UHe  }T 0 80 <7 7`t - `%M:p M_ YD/ kew^}//N @ `3  ` 0e } $' +v BDW7iB@~2P  0 ( p  pF I- Fpw Rg1{K r P7C `   P f  Чz l 0 'D.J \  l@~p@\ O 0 0X  ( C  x 9x 2e @:RI ` j;{JJ +  : [4 Z0 3 1 A 1:Ck QS b r}(5U <`= 0sR /@ < Pz _ +xj4? Aa M7]S u`P мC @ :  `w0 p L&  ';7PQ J bc pq  E : pZ ee  !0: 0` F:\` g3x0 ~jB \ epih .  P  A@ ,@^5D  R Y`m g`/ pV y8< 7 C P 7j Pkt %  7 DQc0) kyPz   c0 Q  / P = 4  Y%p 7eRP g0 `0+  04  `H { p= = ^  @!  l ) `9 9 H [ di p` |   P<@ \0 < \ ;   ! C) !e"! B! G!@C [!  e![ y!L !J !4^!!!~6 !P !@W "X ". )",@"9 Y"A e" o"@ "S "` "` "Pd "S "`"Y "pj"t #( $#36#  R#:b#`n q#8#4 ### #q# #B# ##c$:$-$t2$ X:$XN$ W$t l$P{ x$0 $;$p$b$3$ $$=$ %%  %r: -%j3%' B%hjN%g%Q u%^% %S%n % %  %%e%(&p &.&+ ?&\ O&ЂC `&@~ u& &C &} &;Q&p' &0 &p &) &e& &X'Ȗ'':-'2'@   C' \'c f'I v'r 'h't* 'e'A'u'0Fj ':(e#(F 7(Ю5 E(ljR(Q e(A x(dj(x(e(e(<(<^(( _F (8 (PJ ( )e) = )):)jE) ])m)) ))d)` ) O ) );)  *F *" *# 0*j  A*: V*p a*Dv*:* */**p *g * *P*Y*p:w +j+:$+ 8+ M+[+k+<t+j+0m +*+` +03 +@+`f +  + w +`* +9 ,  ,=&,8^/,P >,p3 P,p]Z,\ i, g ,t,  ,,0$ ,D ,h, ,7 - ~ abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidshostnameoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerinit_default_instancedefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_val__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_raterecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registeracl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsfreq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzerrecalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0pcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1http_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroygetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlineeb32_inserttcp_splice_initfdcfg_cfgfiletrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0chunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icbuffer_replace2findserversess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaydisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuenb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0tcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0stderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_malloccfg_parse_listenwaitpid@@GLIBC_2.0acl_match_dirparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301pool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0acl_seena2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopinit_proto_httphttp_200_chunkstrncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requireregcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_token__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeropollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onesrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warninghttp_err_codes_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2recv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingpcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info