ELF40 4 ((%444444x x |HHH Ptd\ \\Qtd/lib/ld-linux.so.2GNUaiW@d,eL)NB>(&M/8a\K[cUVZ`Pf96H<Ig bX4EY 1A Rh3$_T;^O "!'2 #*.0=C:?7%QGSJ+F5-]DK(=H1;`Y/u=H0A7gM"//vD7IW1{o@b*:; :Z:5/%7q:;]:CPW:3!B5.AQ7*OWR HS h,#3L:8#q@c6:8XGQ ;b3,b=^S#(@ t:hyuO:iDG;DJ:R 8/t:  @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strdupsigfillsetlistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_putc_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfsigprocmaskgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii Bii Lii Vg&'3TW     đȑ̑Бԑܑؑ  !"#$ %$((),*0+4,8-<.@/D0H1L2P4T5X6\8`:d;h<l=p>t?x@|ABCEFGHIJKLMNOPQRSĒUȒV̒XВYԒZؒ\ܒ]^`abdefhUS[W2+[5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%đh` %ȑhh%̑hp%Бhx%ԑh%ؑh%ܑh%h%h%h%h%hp%h`%hP%h@%h0%h %h% h%h%h%h%h% h%$h %(h(%,h0%0h8p%4h@`%8hHP%<hP@%@hX0%Dh` %Hhh%Lhp%Phx%Th%Xh%\h%`h%dh%hh%lh%php%th`%xhP%|h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%Ēh` %Ȓhh%̒hp%Вhx%Ԓh%ؒh%ܒh%h%h%h%h%hp%h`%hP%h@1^PTRh$hQVh0CUS[øt[ÐUPP=t ҡuÉUQQtt hfÐUh4$(ÉU hh@h8XPzQZYPj ÍUPP ,PEh@PhPj^v'UPP5UQQjR{ÉUPP9U]G:&UVS5 hH9J^\QhtjV:uRR`P\PC4PC$P Cuf PPPhh^h@(h@hC9h@hjVq: u^\N` RPPPPPPSNduPRhh^h@n@PPh@h8h@hjV9 e[^]ËQRPPPPPPShHh^h@0jPPPPPPPSQRFdPF`PPh&'UPPpUWVS$Eu EE} E    jj|H| x   wlCUB0Q|7|(  v@PPj/PuO8-usX@^HUtɋC d S9L= P؃u R聄XPtXPg$Eu F$EFP_^SvYV RlXFPbFt)t&à FCPA$9Fuۃ V&끋\UUVS1ۉ;}PPVCPa;|e[^]Ít&'UVS]jj9t&PPEPh  @  @ 8 V1$2$I% ޅu ue[^]jvUWVSEE PEP^_h`j_iY[hj LiXZh0j>i_X}jj 4 15PJ!ƃu6 t, WjjjjEE' Ky L VVhjhY[h jh`Ѓߣ`t t pXuTXtEEEQQPjO@\C| d t@RQlkD@t PB@EESESPjUT9`=H1~G<0t8U܅t]WPh3S YUR1TF@95HTE܅t EP pPpt-pt{ tu95Htp`tt; P/X=W"^S`` Cj=u {6 j S9!Ydrwd=HEEPPEPj @P\PE Ph#sE WW0Vh# P@ h1rDh P@UPDPE Ph@"XjeQQPPLPE RPh`# X P phhAPSShnPE% RXPXP`XM RPPh"M WW1Vh"t&M SS Qh7 t u j PPE Ph!XM PPPhXt!=u 뤋M PPPh=@M PW1VhpQS@t$E RQhlQ lSQM Rh u  *=pPE W0Vh뺐USMAҍu1[%]Í'US]E Ch@z‰1t#1t&ʉDAv]ÐUWVS] u Q\Z|S{T‰Ce[^_]Í&UWVS } WU^ 9YtPPWPtC9Xue1[^_]Íe[^_]É'UWVS } EEPM^ 9Yt!ƐPPPP'tC9Xue[^_]ËSCBCE]He[^_]v'UWVS }tM1  SWSCBC9uFv PGe[^_]ÐUVUUUWVSu M]~)<;}|o{1%A% Š1҈CQA% ŠC1A?Cu [^_]Ê%Nt>1ҊA% ŠC1ACC=C1C=CېUSQ]{t]Ë9| C]RRjP( C]Í&USP]C~ t C]PPjP, ⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P1C1]Ít&PPjP, C뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU \EPLHP@LX\]Í'UUJLBPABPBLBPBL]ÐXUV1S=XXtC0uCLX=Xue[^]à SЃ ƋCLݍ'XUV1S=XXtC4uCLX=Xue[^]à SЃ ƋCLݍ'XUV1S=XXtC8uCLX=Xue[^]à SЃ ƋCLݍ'XUV1S=XXtC뇍&E ;]%uve[^_]ÍE9sJ'USMEut[][]4t&k[]Ð&USSS]jnjh $%@lvQjkSh(]fRPSh]Ív'UU0 vv %&]Í&'USMȊt,Cu.t:t _t-u Au1[]É[]Í'USMȊt*Cu.t _t-uvAu1[]É[] UpVSt ]x|SÅtePPj:S1t@jj jPƊ<*„ Шt7tf frfpSep[^]PhtSju Sst@tPPSh 뎐&UWVS}WDžRRj:P1EtBCPPj-SƅFjj jSvjj EjVdƊ<*„ ШtIEffE U Ef0We[^_]ÍvPhWju W&t@뎉HPPWh rUWVS(EPǃ1txEU PPj/WKÅpPPj.VtCPEPVjtRM SQWjtB W؍e[^_]ÍvEjj PV{t UtF:tA1à W$t@U 렋UM SQWjuà wt )ȋULE>'UWVSEuEuE}uF11ҊڍB=Eu]C]}}EtOFYЀ ƒ.%u3 v.M…%t8}t2GEu}~E UE)[F^_]Ív1[^_]ÍUS1ۋU t&ABHЃ v[]É'UWVSP1ɋE]߉f@f@E E9vm1C9//:%uف//:u>K&UF‰U9w} }}pttht1e[^_]Íe[^_]ËEPS&Y^tӸP;:t fUfBCSZ鐍&UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEAAFA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CPƃ1tPSWV9e[^_]ÐU jhhL_p %Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVSu]}V\M SE)ȋu)ƍ19r e[^_]RC)XP7WPI EPEPE PC;E wKC ;E vC C$;E vC$CCхu;C(r e[^_]C뮍t&v'U1ɉWVS u]U )Ћ})NjS9s SڍBX9s e[^_])PBXP>VPqEu^C;E vCC ;E vC C$;E vC$CCхu;C(r e[^_]ÉPEPEPE Pw닍&'U1ɉWVS ]u} S9r e[^_]PC)XP7WPEE…%udC9wIC 9vC C$9vC$CCхu;C(r e[^_]C밍&PEPMQWE D y&UVSEu] PMQF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EEE]WhSEP: G$PG PGPGPGXPhEPu G9EvEMQShUR;]}3ރtvPD;XPhfEPt2C;]|͋EEEE Ele[^_]G냋EH9tPPuVj C봍vPShqEPTPD;XPhfEP<wEPjjhz믐USD`t0tf EčERRPEPY脿 ] PEPEPEPEPhP轿 S]SQYZPͿ]ÐUSD`ttf EčEQQPEP Uȍ] PERPEPEPhP=ESPP[ QM]ÐUSQ`]ttERPE PS$]ÍUVSuPPVP脾tKye[^]Ít&'UVSuKxPPVP?ue[^]Ít&'UWVSEE u]= Ȩ ;(G9EPS)PRRE^);EQED Kx(EE‰EEEx2MD ÉD D D }G}1;}t&D1һ fft$3 G;}|1;}Dž||G;}|[|E t*f>tE$|E 9D)|D)D);E }E »tt dd0gfffttKttU)ʉttw)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh M\ Ԥ‹  Фuȁ?BEU;x %PEhx P~E 9E%EU| x  | Mb)ʉ ҍ)Ѝ x £ e[^]É@B@UE;x 4;| )E9FRU ؅t1Phx V U)‹E + x:ԤФ#  ԤФEU@BԤBФUWVSEؤ]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERhPeؤ[^_]ÉڹQPЉ )ʋMRhQ¯U‹EHUE%&E.P)Rhhؤ~ؤEEvڹPЉ)ʋMRh Q6U‹EHUEfؤ?ډ)UWVS}W< 5L0$\0 … ШuAf\AY C@Y ;|rA D3$WD Hx4 Ȁxu t&Jx (ʀ8t  e[^_]ÉA됍t&'UWVS 1=9}-1PPEP PKu ǃ F<9|Սe[^_]ÍUWV1=19}; tF89B8~A<9|tF8t VV$uF8te1^_]  e^_]UV1S9}1 F<9}"tS8t FSS(<9|ލe[^]Ð&UWVS EPjjhEEE 19 t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99 uP PEh,PƧ MQj jh53 $ EPjjh@~E@EPPEPCj 諩 <9cv}19} PtUB4uMPVShtQe1[^_]Í&UEPjjhUjiRPEhiP¦'URRP uà h  Ѓu h  H 1ɉÐUSt'B HCЋ]á19P~tLJ AJ 1҅t̓ EP$x8ڋEC CEC@뒃 R@믡P JP 1i&US]CPaXKQWtP JP ]HÍv'UUu&B @H]]x&U jjh|>ÐUWVS }u}t<\tFGuEe)[^_]F1ҡDPt50MFT~~ӋM )RSPW ߃듐xtFGFF 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡDPuHxtVVPh 1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjjۦU PUp Pe1[^]ÐUWVSP\`8`dRRj,P:`t @`PPj:dP胥Å PPj:CdPbUhPhjRC pfDžh PdWj " PPj-S蝡W@jj jP"jj jSÃ@=G=v)f fFV  AC  9cPPhjI hƍ@ hRP3Ffh uf fFV뎍`t`8[ \Pe[^_]PhhjPdfDžh<*„ Шt+DžlPPj-SFjj jSPlPdPj艠g dPߣtl@l?SSdQh?\ZPe1[^_]PdVWhPdPShQQdRhPPdPh 뤐&UVSM ut~,ttx1te[^]û܍v RUt,RSRPuV]SMQh,e[^]úk͍v'UPP1ɋEP89P8tEM PEPQht UPP1ҋEuËEPEPE PhRÉ'UPP1ҋEuËEPEPE Ph,É'UPP1ɋEP@9P@tMEU PQRh UPP1ɋEPH9PHtEPEPE Ph UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًMSVWQ!uƋUSVWRNt뱐t&UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًESVWPtĐ&UWVS E} u]SVWURktEEe[^_]ÉSVWEPuًEe[^_]ÉUWVS EDžttHu$``te[^_]Í&3t"u.||븋 `t `e[^_] t#% u||g|.u |5 u |>u``Du5tUB8jj jPdtWu2=xUB8tqjj jP!x{1uu1Ciu1Cdu1Cu~5@UB8tjj jPɜ@#RE PEPhLsDžtSU REPhNDžt1gu1Ciu1Cdu1Cu5DUB8rjj jP"D|>uG@u+f E@POt|@ SM QURh6fD E@P讘td@PPE PEPhę_3V諙ZYPP貙;XWUrV] SMQh4Džt z{XPb^_PQiZPUBPE PEPhlPE PEPhElu5HUB8jj jP蓚HsLurUB8jj jPML=@=@ h@P} WuVhL@DžtEPW{ u2PuڋUB8jj jP赙P u2 XuUB8jj jPrXu2lQUB8 Pl U1۾B8E FRטU\8uޡxt PsPPSjFxËE @Ph1SUÃB8PEFPh1S͚UÃ֋PE P}Wh\2V] SMQhE1X;= 3fGu*u% _t-€.%uF<3ut7<3u1tt PVE pVttUPE P}WhuKpu6UB8t P pPE PEPhXrU Q1lu1Cou1Cgu1Cu+UB8tB8uzEPE P}Whh`UB8<jj jP脖h2PE P}Wh PÅy(UrV] S1ۋMQh(DžtUB 8vU1B8UB8/ fDžxPxP|PU@ Efzu fDžz=|=PE P}WhXLtt fDžxP xjnPR듃 PCDž)E@PE PEPhtt1xRjpPh脕5=1xQjpPhV|5= PƅtE1P RE PEPh7ttBPE PEPhQU REPh000tK tރ~t. ~ uۃ h E0V] SMQhpRREPF P耑u h UPhh^h@跔h^h@jjjEPV |/h@E PEPhDžth@u V]ShU hlDjh ,8,TPPP\XXXlhhhÍv'UWVSlEDžDž8t& Dž8UB8 Pt/MVVYSRPE PEPhKDž t&}PPG5PWu|[` xSZYMPyW V] MPSQh*5 CPPhlDj)ã  C0ǃpC4C0C8ǃtC d}D8l%U tV诈;uӋddE;jTCTFPE PEPh,PE PEPhDž MQ:t&QPPR!uPE PEPh~Džs ~މPP;u鋅@ * }_@ DP裇X=4W薇^<S艇YPR|XpPpXPdXLPX_5VK[ 0Q>4 LR@~ 1iu1Cdu1C \UB8jj jPՄ5ddg9tꋽd9duփ ] WMVSQhH DžE SPEPhDžEU QQjSRPjP t DžUB8PE PEPhu}PE PWheUEPE PEPhP6&uPE PEPh1tu1Ccu1Cpu1CB fU1۾B83ZM 3t& UUUU}@:tm1au1Blu1Blu1Bti1ou1Bdu1Bdu1Bt2uJ op=DžыM PXwN9H}*u} uPWVhD誽ً ‰ME RPEPh1au1Ccu1Clu1C } OQt* W}RPE PWh`Dž 0VVPEP8EM UXSQRh,u]>u WVShDž޿9S7 ZBUJR+ u1^iu1Cfu1CtX8PQ0PEPE ] APv h,uD8DžC)}D8P PPDPPl  !ÉE;aUM ZUSQRhcDžX YYQt$EqtRjhPr5}džwDž>g}D8PPPDP !ÉE;a5 $QrMBI%@B9tuv > jotRjhPq$ǀ(}PPj5G}PE PWjV t Dž $S2rB% B7tuh Pp_V pt4$n$EYP R@PhV$Wp ( jntVjhPPp$ǀ(`UPP} uPBPPWVh@1 Dž& މ}D8/ PpXDPo Pn UPP} uPBPPWVh@f Dž[ މ}D8 PoXDPo Pn {UVVE SJQRPEPh蛫 Džu } FPuPWVhj Dž_}PPPGP}PE PWh0 Dž%u } FPuPWVh DžuPPj} FuPWVjS t Dž $Qn=UG% GB8}w > Pl4$}lMAZ8ts P`là SRk=$ZUYB8u'MPA PAPh0S$P$m (Z떃 Pkp4$j$Wh=V$Vl ( jjtRjhUP8l$ǀ(HESSjU HEQRPjPA t Džxt B BxA AϻMAPE PEPh藨Džl` t|PPEjPE PEPjPL t DžUu ]:WVSh\胨PPMPPjPE PEPjP t DžuF8K H,Qrk}ZGPjC,w$Z ÉZ^USSjE U QRPjPX t Dž  t|9\u ǁ\u^%uu1Cru1Ciu1C0K}G8JRRP\P莍PE PEPh耦pPE PEPhTD  }MVVjUM SQRjP t Dž}wE@‰1iu1Bfu1Bt!X8uH0WSPE PRt^E AlQlh (u FPPE PEPh, } M UwVSQRh̤ UPE PEPh蝤U}PE PWhnDžc~ utAA>MPPju 9] WVSjQ7 t Dž}wP@P޿sHH |:}W:PjPRuE NEPE PEPh/PE PEPh4DžPE PEPhpۢDžb  t|UQQjE RPEPjP t DžMPPj:APat^} OQ{SPS PS$@ C(3Eu ]8WVShDž u} uPWVh7 MPPjPE PEPjP t DžuF8} OQڎ1 W}RPE PWh" UM USQRhDž1lu1Cou1Cgu1CEX;t-@8u ;t uF8u%U EQRPh,lDža PѡÅ}G 8U1B8UB8/ fDžxP.xP|PU@ Efzu fDžzq?xQjpPRjby fDžxP@ xjnPR"b{ P}DžMu ]yWVSh$bt USSjE U QRPjP謾 t DžMA8t A8uPE PEPhL< E hhPEPh Dž MPPjPE PEPjP t DžuF8 PPPaǃǃ_}wV讋|PP@ wDžXX>;}t>|;HHdd};wE} uPWVh茜DžWWj j3` }jwVPuwE @PY_PjSP޸t(PE PEPhU} uPWVSe_M USQRhxǛ uDPPE }hPWhl\ C CPePP@ 0 މ}D8t P^ } DP] W\ ddUM USQRhP;+QQMhhE RPEPh u ]WWhhhVShHƙ  PƅiG PE PEPhgFPE PEPh(Qu ]WVShXZDžOxQjpPR\SShj\Å SDžhB\Z\AhC@CDC@x | EC@P[UXBP[PPj:WX ƅ@jj jPZ1҃fVDPu ss W^SLPSPPST@ CXfffCN<$[Mq ǃǃǃǃǃǃǃǃC<ǃDž>1iu1Fdu1FUD8jj jPiY=| @\t9t ;|L苍u >Rt8 fuff f{{Ct%pdFpdCCwfDž"H`AH`ٸO }D8jj jPX~W RPE PEPhH蔕 MM USQRh^NE}PE PWh(t# [ ^ {)CC}@4I} DP%W CDP%VC%} TRV CDPUC 0o70s ? HR}D8tz PV}jj jDPUf} DPPP@ E RPEPh{kukTDž@TP}jPDP趉Mbg}D8CCP PP|W迀S\PS`PSd @ 9щChtgA=s9k)PPrD6PjT1ɉ‰p 0~fDJA9󋅸U8]}t>pCC5d5du 9nPP}P]u WVShlйRRj jF }jGPSP E @PEPjSP)Uu :] WVSQߤ ^EU EQRPh?Dž4FPE PEPhx9u ]WVSh۸  (uPPjPE PEPjW诡 t Dž}G8t G8*E] M0VSQhlO?1 tsPPEj}PE PWjV t DžUB8tB8uYMUM SQRh軀髷}PE PEPh茀Dž遷PPj j3D ujFPS'} wVUCPjSPڜ/'M UPQRh / MSSjE U QRPjP͟ t DžuF8WWj jFC }jwVPu`jjSPEPE PEPP蹡 8U} uPWVhDž_M USQRhx~PE PEPh~鵵 / MSSjE U QRPjP艞 t DžuF8WWj jB }jwVPZu`jjSP辚EPE PEPPu U} uPWVh}Džʴ_M USQRhx}靴PE PEPh}q / MSSjE U QRPjPE t DžuF8WWj j@ }jwVPu`jjSPzEPE PEPP1 鰳U} uPWVh|Dž醳_M USQRhxi|YPE PEPh=|- / MSSjE U QRPjP t DžuF8WWj jz? }jwVPu`jjSP6EPE PEPP lU} uPWVhM{DžB_M USQRhx%{PE PEPhz / MSSjE U QRPjP轚 t DžuF8WWj j6> }jwVPu`jjSPEPE PEPP詜 (U} uPWVh zDžOEU QRPhxyѰPE PEPhy饰  QQMjE RPEPjPy t Dž5 }W:td CR*<EPE PEPP Uu ]:WVShxDž˯7] MVSQhx韯uPE PEPh$xpt"UB8tB8u*M}PE PWhxDžVVujM USQRjP t DžPPj j; }jGPS E pV:PjSP7@ M UPQRhfwVGPE PEPhx9w) uSSjEU QRPjP t Dž}G8WWj jv: ËEjpVSM AP9PjSPiPE PEPhLv_M USQRhx!rPE PEPhTq [ MSSjE U QRPjP蹑 t DžuF8WWj j25 }jwVPE @PT4PjSPٍ%PE PEPhqU} uPWVhpDžΧ_M USQRhxp顧PE PEPhTpu  trMSSjE U QRPjPM t Dž5 }W:tK CR2U} uPWVhoDž鸦?u ]WVSho錦uPE PEPh$mo] t$ t% AERRjPE PEPjP" t DžUB8Mjj jYS1} 7%\ Q0ËEZ@P0D$/U5ËzWVh1S2 Dž9`#G~ۋ} uPWVhn$1_M USQRhxm: 00C tރ~ F uӡ ,Pa1,0_ Qh/MZËAPY/D$M.uËFPP}PE PWhmMPPP~ W,' }QRhDh^h@/h^h@h PjWV |/E h@PEPhlDž\E h@PEPh>lDž3 } uPEPWVhp l DžuQQjE RPEPjP t Dž}G81VVjP/ƅSPVj-D^~8 U^h^BPE PEPh,k  S], SPV 09M E YSQRPEPhjV*XP.סE HQPE RPEPhj x V*鐡PE PEPhtjd VH*ujj jFPs,Dž94`# G~M] VSQh`~jXP-ERRjPE PEPjPۉ t Dž@erroPEh^Dr neh@Har 'PLbalaPnce'TU>QE }h@PWh3i#MPPh=PE PEPjW t DžuF8qjj jP*UBPE PEPhxh鐟UPPjPE PEPjP芈 t DžMA8 R,uXFP7+= P&*Dž Ep>tXb5FFU@;u VЃ H!ƒ t1} uPWVhcg=PЃ4H!ƒ42EU QRPh$guFPE PEPhxfDžݝ jމuC5F9u ]WVShf針sމu^5FPE PEPhAfF}u} PWVh!fDžzމ5~~%}VVjM USQRjP܅ t DžEX UB8 PPQ)M_qVn( PPQc' uTjj jVRX'=XX?~;E j?PEPhreǀX?鸛PE PEPhXd錛GfM qN=  }G 8t4W1lu1Beu1Bnu1Bu UB8u6M E YSRPEPhc ښPPjj'áuXF P& C~ W% Cjj jvV% C @jPhCQKD u}SPE PWh!c V o}w W= UB 8t4R1lu1Beu1Bnu1Bu uF8u6} WRPE PEPhob _PPjj&áXEx WE%U Cr VC$ MCjj jIQ;$ C @jPh蓻CQKØE u ]PR8WVSha 鍘u]>u WVSh$na^E U SEQRPhL8a Dž- uD8CDž]u WPVShx`  މR5^^HRRhwP%?PE PEPhw_gU PPE PEPhLA_ Dž6uD8Cjj jR(!--N PPE PEPh^ Dž鳕1] MVSQh^釕qމus5N NM} uPWVhH;^Dž0 kމ~}\1<.CRRj.PK SKu LQ B1iu1Ffu1F6XDžC铣M ] tMVPSQht\ ٓU} uDPWVh\颓}PE PEPh|\l}PE PEPhLM\=u ]P>u WVSh\ Dž DžDž} uPWVh [’u ]WVSh[阒UB8RRP\PBUPE PEPh;[+PPEj} uPWVjS${ t DžUB8tjj jP lϑuWWh@] 6MVSQjRz t Dž}G8tLjj jPp EU QRPhLTZDPE PEPhL(Z ,W,0Ґu ]WVShhY飐0'OuF8<SSP\PBKEU QRPh1Y!ME RPEPhYDžEPE PEPPW{֏FPE PEPhxX驏FPE PEPhxX|9u ]WVSh`XPFPE PEPhx3X#9u ]WVShXuFPE PEPhxWǎ:u ]WVShW雎?u ]WVShWo6] MVSQhLSWCUPE PEPPy"GPE PEPhxWUM ZUSQRhxVōPE PEPhTV降PPj jK UjBPSuou ~WqPjSPr6] MVSQRx .}PE PWhVMAPE PEPhxUԌ}G8WWP\P?] MVSQhwUgMPjPAPL} uPWVh)UPE PEPhT  E@81=2fGu*u% _t-€.%u F<1ut <7t6E HQE RPEPhL T UPPBP\P;Ԋ} uPWVhS骊 M1I9tx1} CQt08uRRVjNjE @Ph1WU4B 8uv8u x\VVWPc;! WΉPP\jPr:} uPWVhR鄉\QQRPt;`PE PEPhFR6 \P+8PE PEPhQMPE PEPhQ龈 W ] MSQhQ鉈MPCPh1VUƃ8u܋JBU}BPE PWhdQ6 UWVST DžMDžhDžQ,RPhP @DžV<0)=Q1F1DB u1ۊtot&\W#€  Ш 1DB F1DB uCƒ?%u:C@C@~1nu1Bou1BDž1ۀ8t%t&C8u싽t4uPWVhOt[ ǻt@ljt-ljt  DžQNZPq}PPPWG~ ‰K PXPe[^_]ÍN €\ Шux#tsrntxuMF9s FP:oRPEPhkMFgDžP)FHBPRV)2 ]hPSh@Lt   냸 tFtjR]WVShlLN DžPCXPfMVPSQ|o&B FP[9yF F00 w< vDž|ݍ&'UWVS$EEjjP]EE졌uЋ]쉘Eu裌E t&u~ \ UB M싑xt <u~}NhFnMI @t uF,Q]{MϋqHH9tct&Sj]KQV RMBÅ;E] N Q?^ M1ҋptp ‰p69u]{wlxt pt"tTuF\tJ|t u6E xW<U VPhIJ]]} tEM싑tW9OMxtxm9eMAu싆U싂Pjhh΢]u u1F\u ЋUB\8Eҋx\uMAhA|%ǁ== }W]f{yu~w"xtt Ex\:UztBwu_ t4M xQ';] RPhHuFu?uu~\W0G,9W,uPPj/V ÅPjMCAPVs?EjPPSuV9@ƅm@E9EtMË@Q%@@9 P ?(EÍpT,EpPu9XTtRuF@t BBu쉊ǂǂl~umUBPjFPF,P >Å\;E+U z,W M1ҋpY,tp ‰p]{WI ;{uVjjK Q=ƅ;E { W Us p1҅tp ‰p뛋E싈NP\CWWVhUE]C]!uF f^ [NhG] %xCQ7RPhhDbEEE R7] RPhDE@xEn uV=]É],MA Rf7 WPh QD]CF]p R67] WPhLDuCu;PF PU싂PhC]C6]t uG09E싘 xQ6U RPhCE@EU싒U} M  t71ҍu싂$Ft5d, Ɖ5d uхt11ҋu싂Ft5d Ɖ5duыE싀Euu~ ]]Ee[^_]PF PE싀Ph xP5ZYVSQu싖RPhL]BE@ ?E,]쉃tu]uPPSuV:ƅE xQ4$RU싲VPh|M xS4ZYV]䋛SQu싖RPh;RjPh,M;QjPh  ǁ(jl] $jhPu싆|t[tytb]쉃x EP = V>>EY QU쉂tu싆|tmx ]S9MMM싁xuF\1 xPG3 WPhl@U쉂xQEP,RPh?E@E6P~,WShPC PE싀Ph?E@E h<?EEe[^_]à P2] RPhhi?E@E PQ2 RPh?}}] xP24$QRPhRC Pu싆PhT$t&U4EP04]ÉUEPQP@ ]ÐUMAt x 9}]Ë x )Ћ]ÍUUJtH9ttu]ÍuދܐUSáx ( @x Q0 RPh=XxP0YRPhjS[?]ÍUWVS x@P@E9t]2 69tOZC@tC$ C$R[C$u SFC0@6C0E@9EuEe[^_]Í&'UWVS1 tn1Qt&FtVtLX P[K$u SFS0G@S0F,t V9re[^_]ÍvUWVSƋ9t;F ƒރ FUFx V ]E@XZPFEFL QukPhT h^S1:  F4PF$WPFxdt H`k tkRPdR@`Phh^S9(h@h1;}thh@h1j^S=FHduP`tyFt udže[^_]h@h1j떃 R@Ph h^S*9 뀍t&'UWVS Ƌ9t%u9|He[^_]ËNAdu y`m x 9}Ӌ)߉F ƒAFAit!8& ]VE@XZPFEFL QukPh h^S7 F4NPWydt Q`k tkPAdPA`Ph0h^S7h@h19~h@h1jW: FtYuc(x 9})É؋$É$(d VЃN R@Ph h^S6 Vv'UWVSËHu H@SE@XZPECL QCukPhh^Vd6 C4PWCxdt H`k tkRPdR@`Ph0h^V6h@h1(8h@h1jCPS9C xdup`tTCt&ue[^_]à R@Ph h^V5 8&륍t&UWVSËHu߉H@SE@XZPECL QCukPhh^V5 C4PWCxdt H`k tkRPdRx`Wh0h^V4h@h16h@h1jsV8 Ctue[^_]à R@Ph h^V[4 PvUWVS<}t|^@DtBF$u V?F0F0PPjW, de[^_]ËSB u Bt ȋ$B Sh@@(PC$PWS9(t/8 t%D1vde1[^_]è@fCLECPECTECXEfffEPEjPWu  rtswt jEt  tUB4 t )Ѕ$LJEe[^_]ËE H4t)ЅGS Gx F LJPjjjNƃtl9TL$D E… Шu"AUfTAQ B@Q ;A D$V EH4 )…uUɉB4 u;H  LJV6Eh1~f QWhȉ)΍6P$]P$ M}fEƴ fEm]mƋE)ƃ  WEX4W@tJ x  9!⿉WWBit=Wt:G@@t1 tn uuЋH9|~ LJVCh1 QWhȉ)΍6P$]P$ Mh*BmE9WUBi)ًET}U WЃU J4k)…_EɉH4 u;t&;H E5 H4)|W|uuEH4tڅtʅt )؅~ډыUɉJ4u"PhjV@ jhPjjV @G@@E؋E܋EEfffEڋG%EE=uE EG\EȋG`E̋GdEЋGhEԍEtxAxED$VMIMA |1|t/QfDQ%EB;gA|HA ExD tD L$ffEʋEPEPEPV7E#ET L$҉U… Ш&AUfTAQ B@Q ;AAeWB%1E=u Et" @PPjjV W|MSPQV6tJu-G xQW RPh)]PjSV@srj t&GLE؋GPE܋GTEGXEPG\PEPV6EE[}}8PPGPh< t&A jhHj jV( VDF; ~ MLDDD \DDPPjV(  uEH4G| uڅtʅt )؅~ڋMQ4G xPW SPh /Ӆv)ЅjuUB4у G|@PSjjV jOlEMJQRGPh Zv'UWVSEEEEEX\tCvuEEuЋ}D jO$EEX\EU‰E Ctt 2DB @B DF @F$EF0FDF8sHF<0^@= t SP;E S;‹EЃ}~4tF t;~y V$.uMEFuMEEe1[^_]Í& S=~'Et S;E} SEE@EDU@ RVSEQh$ $e[^_]ÿ UWVSQ]CE9r`s,C@tI x 9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjh l} %Ð&UMQPQQA ǂt)H4BJ P JP ]ÉBBJ P JP ]ÍvU1҉WVSu} F4tV@хt_tUFtOCREEAUU䋀9tl%tUى1t2YQK$K$V BV Xu ؍e[^_]à VЃCE렋EU@9B놉'UWVS uFVEZ9~ }7PPEPVt$XC$u Sj+C0@C09~ |ɍe[^_]ÐUSR ] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 R|JUWVS}]EW$VjPjC@PY @tC$ C$e[^_]QWVS@RC$ C$e[^_]UWVS\ETx 9 9LJhDžPQSEP@   2 J AJ  F$FF(0F5  F Ffh t  B @B  A C C$C0CDC8RhhRP9 T\ShjQ@ jhPjjRe @eG@RV^r@B:tF;ur~;}s!1FtG;}s 1u]uU)ЋS9uPRCPEPmuҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWRĕCUM]vE U1DUDUEfDf%Ee[^_]à h8-룃 Rg-C'UWVS]u} UCM$<$B91tЋ^0))؉F4N)ȉF [^_]Ðt&B91tꀸЋ^()B)ػ F,9s|1u\)F0낐B91uꀸЋ^ )B)ػ F$9s,1ur)F(gtJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0tB9o 딻덐&UWVSE]UM}$P$B91uꀸu )K0)ȉC4{)C [^_]B91tꀸu )s()BC,9ʸ1ugu )C0jB91uꀸu )s )BC$9ʸs31u[u )C(UtjB9zu tM t1[^_]øٸҸˀtLB9r붍vK(u ))ȉC,} )C4C0tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$l$:&؋M)CXG9sɊ1Ѐ(C9r몊1ЀtC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB C9_1ЀH uC9 ECUX$G)ЃXGG9s WBW9r1ЀuC9r}_ uC9e uKC9P1ЀuWMA PQ: %PO)R. MY$ EXEEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ uC9[ =C9B1ЀOEDX9VUDX G@GDX97UDX G@GDX9r C9; C191ЀtUXU9_G V !C 9R; 6C9;1ЀtUXU9t MjjSq$VQz ËEpU)ЋUX_G fzt tM fA fAfAG@ @؋U)ЃXG@WEЍPXW;M EY$jjSPQEUGà rG C9,C9y1UWVS u}UE UV EG])ЃXC=^v^F XQPRoF@xW~ ) C  SUCCECESEE Ue[^_]V G$)ЃX럍t&'UWVSLE}EE \E1UMUIDM1ɋ]9EUM@,EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿0C9]s]]UZt@MEȋUM\XDN9r&Ẻ ޿0C9]s捶UEЋMU\XDT9r Eȉ޿0JC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjSh0L!U1D\fDf%ƅuMYU俷0r}&U܋U܅M܋QB9uEypу9u΋U]K0fǃ@fǃx 1| C@1@DA<PPQSwe[^_]ËEEt&ME@VY SQh@脊]EǃXEZUPB,xLW諤MA,@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8 t)Ѕ~ e1[^_]áx )Ћ | MbLJE))ʋM>ʉtWWjSZYPFLP0CF4F8\`C$puPC$R C$e1[^_]ÍvUWVSL}GW< DBUԋU 1ۋB]ċ$E؉MEPPwVjh00]܃ }M؋ERjh0P膇] uE[]9GE01ЈUuqv ҉URqM̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01ЀtMԋ]M9sNwEiƉu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjh0Qڃ>E0'PEjh1P觃uUωPEj h0Pxtˍ&PEj h1PSًUQjh1R@3듋u)MSjh1QxUB<"<, Ш^Ev'UVS]u fft>fHtUǃpPPjSZYPFPPeC$ptu C$%e[^]ÀPC$ٍvPC\PVSxe[^]UWVSEEM EP$ыUf@%ETTXUM EMPfDf%E܅<] f%41GD0EEUjh` j SBP= u?MAw4$$M]ECLPtUM܋EM%1e[^_]Ë]C9CuыEًP I,S[0AC |AMtA BtBǁ`6EEUB[]EK ujjVS] SM] MMQ0‰Q0IfWf% ЉfEfH Eh` @ PSh@HM $h@VSQuUƒ fUUz0ljz0]Kƒ ШUWVS ]}u_O1tLs$E EX EƋK8ΊEUjh` j RGP: tUEe[^_]Ít&Gw$$UB9BuҋMW Y0QI,C A|AMtA Bt ǁ`E뉋MALPҋUBيEh` G PEPh@}M $h@VWQ迶S0{$ƒ S0U DXMSjjPE QXjPCP'ƃS f‹% ЉOƒ Шu 1it&UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWx|uPE SPW&UWVS|EEM EċPhыUf@%TLXMMċQfBf%Etcu}}Uf%481Bj h11VWD0E…u,EE}ċMWfDf%Eue[^_]ÐMċ}}u< E‰U9ruu듋Uӊ<;t<=t<;t C9s<=u9tր;;tэKM9tljMs51SЋ DA u!;t}G}9us}1DA tߋUBPt&MċuuM)΋Tu9C؋Mu);[u<0ًU)ыu9ɉU ]ȋPx p cz Gz t}GRDPEPQ`yGDCXZPGHP胖ÅMȅt P JP Su,   B @B KS:M A1ɋt |C K@C MAP9u׉EċMt uFu}G$zE@m E} jjPEPWͱUċuJ}fV f% ЉfEċufH HtـuHt9u׉ u B @B Eĉʅɉ}GX;E}Ƌ}PVWRWwUċ0MIM=z}WVQRw:  Tz Gz ˅EȋUẺAA QQSBHPГBMAA B @PBPEPEPE P)}uNjU}}fMwtƋwt@ ~  R= R* hX-# MhX-jAPʹ h-MăH R " R  J QBPEPEPE P8uË}fE؉EGt؉Gt h-{ Eh-jXS%GUWVSU}ȍt2  ,Z CZ UBRDSVQLtUBDGXZUPBHPiDžMȅt P JP E1ɋ pt G O@G G^\tgPPGPPpu'CF@Uċ$? 븃 h-蔰 h,.EjXS>e[^_]à R] V hp.Lɋ  z Gz υtZEȋUẺAA QQWBHPUċEH$H$NMȅt p Np h.覯 h. R ZUWVSEEUM Eċp$f@%TLXMMċQfBf%EtiuEE]UMf%؉E1BUjh51RDQEwu(EċMuPfDf%Eue[^_]ËUMEdEEE9=ud@dE9ds%d;€, Шu1DG uËU9d-ds ;=tC;]r;]KuM9M9s=1SЋ DA u);t$,t}EG}9Esu1DA t׋d8$UBPMċud)΋Tu9|r9d׉ua } qB @B EąɉCUBX;E}PdWPQoMċ8u؋dv)l;,E@EEta djjPEPE P7uMuuĉMM}V0fE@}V0EE ll<Ed)d9ɉ( ]ȋ )r Fr _UuBRDWVQnMADCXZPAHPÅMȅt P JP Cuvlv\tLPPCPPRku-F=lB@-Uċ$? 6ul 1Ʌt C K@C uEd9zEtAE E}u jjPWVZUfEM؃ EA0؉A0u9d׉llU@\UEA tuu9sE8~t @UE9rM9Mtutxu)Ή| u6ut_EPt@ ;|u9u׉uыE@mlB@]Mċu6$?u uuċx $?@luH9u%E dUEU ]MU jjSQRХuĉËENufPf% ЉEċUfH fE hp.MIl  z Gz ˅tEȋUẺAA QQSBHP{ E}M @jjPWQ UM‰uUq0UƉq0uf}UBv }EEUl MċEP$P$ R h-ԧ R R h.蜧 Eh.jHQFEċMUB$ɉB$Mȅt p Np h.' uh.j^SѨ\UWVSEEM UZhf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSM }]Q,BPf@ %PBLf@ %PEPAVQh<1h@f]Ɖ)) 9~@RP@WP臍ƃƆ@ FuE @Ee[^_]a'UWVS,EU}@,R0EUMA4?_\A]9A$sGVPSQ`J]ЋL]Ћs@x!E UHQSRP@p$Po M]ЋA4A4ȋs XCE|߉|PPs,VS(ЃXP踕===M}gEH$pH$.MQAZ@ ة!A$_GhM1fCETfCf%LXME܅E܍]ԋ]Uf%؉E1BMj hT1QDSE藽t?UR$ŨPjh1ScE̋]E̋ẺC$U܋_UfDf%E܅]1ۅ~5t&~%CPGPEPEP 9ϋMA9ƋvRPEPEP\Ut,048M]A4@@LJ]VVjSZYPExPW|UR$Upu MPỦQ$Euű]űẺC$e1[^_]=,u=-?aUB@N0: EjjPS]S蝚OtU]‰OtUOfS]f % ЉfO Ef Ejh1PS]SAUԋM fWtM‹MWtI$M=UtDHTXd]Su<uPu B}SBt ]t"C$u[Ct?88][$]̃uVEP@Z@ ة!t>~BEЃx$E@ M|_04ẼE̋EỦP$<Gfxt WtMЋ]f@ f@f@UA K,‹C$)ЍPC)9r*C,EЋULJB4B4])s0։s0PPEPEPEP]SBtDHTXQ_1tQPh/8UX_1tMRAVh/jPĜ u]PPVSBuX/PQhj1h@D_UÃB ES_h@SPEP護M A@t tG\UЋEZ ؃XEƋJ VuPVh1hO1]fATfAfӉ]Á9fM%U4VQRh1O1DD0EfDfÁ뱍&E@4AP]ЋGxPGPEs XP#cUMЋY@x#] CPQRSCp$PU M@]U@t,0M]AC4LJ48PPjQ^_PsPVvE@$Epu @UẺB$E]̋M]̋]̉Y$sUЋJ@x&M uAPRVQAp$P ] U@M@]t,0UMBA4LJ48QQjRٸ_]ZPsPVuE@$Ep0 EЋ@@x$U BPEPEPRBp$Pb M]U@@t,0M]AC4LJ48VVjQ_ZPsPV"uE@$EpePT EЋX@x!U uJQPVRBp$P M@]t,0UMBA4LJ48QQjRk_ZP]UЋJ@x&M APERPQAp$P] UM@AB448Y$]pu ]̉Y$EAE E̋EỦP$(My,RP@h1PZ ωujh1S]VSt h Gjh1PEPEPK] [$]MA(^y]Ux )ȋ | )Mb)ʍڋUщRAJ@!ȩt"]PjCL@ PCP@ PLEPU}Ot ǂR]ǃǃ]33v'UWVSM EUEAU9A$sESPRQ`U2}O@x!E u PRWVP@tP{ M ȋY4A8Y4]S ЋS$XC轴}UZdXM|}O4TE} }Ew\~8^8|u7?9 EMjPQVWX uӅ%tɋM]| x ǁQQjS莳_} ZPwLV/qEX$puPX$u UZ$1e[^_]ËEx$x$zUZ$uur;|tj@;v x 9ZCZ;vEX$X$U MqQFJ ȩ!]u C$[1fCDžhTfCf%tXplt&lpdf%<01Cj hT1WVD8pPt3UZ$Pjh1VTG}_$UlhZfDf%lY|1~8EX|GP\PE SP|9ϋ|\t}|ƋX@@9B}vuD9, EjPEP|PCPE‹C xuŅ1҈…tEE@C=-=/ 5VfQGG=^uQPRVQ{ SWK =ZEVQ‹KQRQCW‰Ws WE wM| wC]x QQW] SLR2}_$$|ƋxHH9u uD?9s EjPEP|PGP‹G xuŅ1҈…tw Ur@;v x 9B@B;vEP,X0C B|BUtB B|࿉B|Ft@B|Ft Mǁ`}_$_$|z,eM@y;v x 9fB@B;vUыZ0R,C B|BtA A|࿉A|Gt@A|Gt ]ǃ`}_$_$;|nF t <Ju<uEPPtUA]SFZ t}fff  F B$}_$uEWGr@ !t0Ex4UE J z0x_0}_$iEE } G(^]GM]x | Q,BXJ(B B$B B,B0Bt} U  G4G4B1ҋtt ‹M ҉Q8u ] C8gEp } uRPWVlUt E@@x$U BPEPE PRBtPB M] uAǁC4WWjV4ZYP{LWh}G\`EX$UrS pjjWVu VAMpd‹Y0pfWY0Yh f% Љf]fK UQQSR2i} G4 jh1WVu V賅Udp J0pfJ0MY$t@;v x 9 zGz;vEX$X$#pg$ U MyQ(RQ,Rj?PIM] AS< { )z]{4uE K ȋS0Ѐx_1 9$ ]Eu}VS@EPEjh0IE  } MERjh0PK U B4B4} PvIG PWIEGU SeDt-CoDokiefD : GMGRs VK$QPIWC ЋUGf GGE褨`1UJr@΋JD)Ct19}`<?@9|OS=ZCMRPQICOOGUЋ`QVRPHGG2} E S]E K QS ЃXPEP}}wu} PPWV@MQq]f{$x SdS t}(!;EH t](!;nu(PSPh@GX1ZFP1FP1FP1P@h1PIËESh@PE} PW EM| ǀx SSjQZYP]EUVPZ,E SJ(ȃXPEuj.VPj WC]SaWPËQh@kB @Vh1PDËE$h@PEPE P葜E PpqPSO}  W8t ) UB@x!M APE RPQAtP ]ǃPPEjP^_} P_LS]EUBG4\`Z$M! M  M jh1SSQzWƒ W}GRSP]C@x!} GPE SPWGtP E]ǀVVjSZU YPBLP\}] MGC4\`_$pu_$rEX$aZT)ÉHBBrWSQ&} @҉M A1ɋt u] K8 R h-|ϋZ)ljHt'BBTB;Z)z MEVSAPjh1u uRM]UB19ڋ$|9s EU190|9M q4q4EUSPEЋMQP%rG]M9*EH8XEp11EE4UrZ뒍UWVS]} P<‰Ƌۛ Gte[^_]Ít& PI=1҉Gtۉw$эt&U1UMtzt]Ë tA ]0z\uߋB#FF 1ɋ tt)NGGWWиSrvUPPUB(:u# u%tt/PPjB P4 ËBBPPjJ Q0 BBPPjB P4 ƍUWVS u^,> FF DC,ډ\K,ST % = 0%=8C tUC,u{Tt%"=F(Pt+F@u%P = Et UUP)^K$u SiS0S0e[^_]Í&CTtPPjF P0 FFCuC1ɋ tt K #aC1 tt lj{> Vx2FF F  DF d~ W8 ^^C0u{,u [T>UPP t A @A t.B @B$B0BDB8tF B@tHB4B<@vtJ t;By Rng@1à Q胹f뱉UWVS =t 1ҍe[^_]Pjjh2 t   Et=D_\;E~Et P 9}Ƌu⋿uË}GS}jMFQh"2W >RjVh)26  @ Pjjh22"&UWVSE# Uu<tfEHuEHuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]á`t:tt2CuO2PPhX2h@ Ph@j CS PSUSRu HE4 U_UE PEP%Ív'US] t P JP Kt  H IH  P JP []ÍvUSPv HPa<uC t S9tlC$t- CPȸSDH tt X KX I ]눐UWVSUBxHtUztUB`J\@Eǁ uE9}}]UU1Ett A#;EtG uEU䋎)4@E9}UB\믋E[^_]Ãt01҉Å;E Шt΋ ]놉농t&UP\@d@`@p@lǀtDBt2 u.t*t.Adu Au@AdApu]ËA`@A`Alt&U‹H`t @lJxBt]ËtBxBt]ËBpBtBdBx] UVS]Ss;StMu3SS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉSS빉UWVS}G\LJP{LJzLJEÐu]w|EEt4t&1ҋCCtnEȉEuЋE9E}EuSSjMQLJV}e[^_]-e[^_]Ðt&EȉE됅@+!Ut&t܉u}UET&'UWVS ]SK{9 P()P(CwdNGpwd9tBtt ut቗l kufvSSe[^_]Ë;䍇GGlG`HG` P޲ǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPS蚳e[^_])QQPW^jUWVS u^\dždž0}džЂdž$&CCu߉8FlFp^\dždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPWͱt&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFpFd@FFduP؅tt>9ut6.&;aiFlF`@F`O(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AlAp;B= PV UZ(B$؋Z )1dE\GGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P8 V!E싗Y[X)ЉVS_vUVSuue[^]Í& S豫XZV )1SPe[^]Í'UVS]SKs9tKu4t uu=vSSe[^] uu;u܃tBVp)‹FdHVpFd9u8tBtt utቖVl)‹F`HVlF` P蛪ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFpЉFpFd@FFduT؅ttB9ut:2;v~FlЉFlF`@F`S )1PPPQCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xpωxpS )1QQURP莩EcCCe[^_]Ë9]e[^_]a]e[^_]aE)plΉplY P豧sv'UVSu^\dždžЅdždž`dž `dž$&CCu߉Q^\dždždždžt\CtG uCt?tHS )1PPPPue[^]Í붍&U1WVSEUu RtPEPj?VT Ã1MC؉])u)ƋEu E3vWuVj&S ÅCM؋U)ȉ])‹EU9EU<=uM9މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1qte[^_]Íe1[^_]Q_ v'U1ɉWVS‹E;@dhEǀMfff EǀSSQR[=LEEE=(t)9~%!?EЋUЋU)ЉENfG/űE@EԋE9,fuStƨ1tPEǀe11{x~#v1Ѓ9v1stыMeEK`Eɋt@uƅC,tAK4t)F @u@1ҩt t@u‰뻃 S9C s99]빋MMK`uSdEEEF$u F(F$F بt@utGF 9w<ЅtwDžuyEkFVFF(EVF$F 맍&Ft&@utǂǂu1DžtF 1ҋF(ËF 1҉F(9rs)ʍC PcF @F G,t)G4tE}艇 W9G sދE;}… ШuZ}ʼn떉F(11҉F(9r)ڍAREt}EMMUMPEUWPJQMEHxU1WttWXx;Gt| LJ1EE*;uuȉ]9_t%!9ڋC4F,tà Vv9F$s밉؅ExE1񋃈UpLSdA@SYWRj&P) EPUSXKt V9F$|]ȅt M̉EWiXUD8jj jPBUjj jDP$U(E: 1lu1Beu1Bnu1BtQ3aUD8(jj jPUjj jtVU@,g1Cr1Ci1CW3 UB8U Bh% BhRXE@PU E@PU UB8a3 UB 8+U$ǂ$0l3.sPPj)VÅ9 ШU Bh0% BhWU)4ZYPV8!Uǂ80UB8q3Eǀ8Eǀ$EDPh5EPE PE|Wh 6܃ PU$EShH6Qh6Ph6Ph6Phd7Ph7UWVS }u]G Vt@(xtPPF PPtuԍe1[^_]ÉtC`u te[^_]ËCd썶UWVS u}]F Gt@(xtPPG PPtuԍe1[^_]ÉtS\t Buue[^_]ÍB,tJ8dd1gu1Biu1Bdu 1Bt&d>dfdp LQX@Dpd:tjd1uu1Biu1Bdu1B jj jpDPp@d:uv h T@Te1[^_] sjj jp@P0…)T=)УT뎍vjj jpDPjjjp|WHp tV@PtjPpAPu\ttoPVh9UREPde[^_]Qh8:Rhl:؋pLQh:Vh:Ph8;볋p\Sh|;Ph;Ph;둍&'U E hD<PEPÍUWVSEEME@U@0Ew $^1ۍe[^_]ËEMfǁe[^_]ÅZ t|u WE2CTT1.u1Bu Mu 9qt-t}9{uƋU KT9ωƋMuf}ttU 9d]fǃ uuhVV} …Ru]8RUE Sh$=h^R]M1QMQ]ufdž }E xFIhh M pRlP Ehhm ] hPdPEhh u PP1҉Ehh RP1҉Ehhl RP1҉Ehh RPbEhhh Pa1҉Ehhk RP"Éhh WP%vZ1YRP}WuVMQUR}W}uVMQSPh@h^W0hh E `R\Phhk U XPTP~hh M PPLPY} c8W t h8Jtm8QVSPEhAh^P uPPV1ۋ}W>&}E Ux\fǂD]3u t+9|t#U]ljT }uE܅u}܋EEPD+ ËH9%E] ]t EEEE?Q}t&E xtU } S PsPjE QRdPTP1U z\sPM x ˋ()P PAdPA`PIt{|ʋ׉ƍTP P} HSDQ@R<V8S4Q0V,SXQTVPQLSpQlWhVdSQM苀PPPPPPWhBh^Q,İ]VVS]Sw1ۃ]u}fLJUhh hPdPEhh `P\VEhhhm _,SEhh G(RPEhh G$RPz1҉Ehhl XRP[ELhh QP^q^Z1RP3Ehhh _^0SShkukREOQhXh^P PP0ukR0ukRGPEh(Yh^P^_0]P]OQMhTYh^Q0hYh^SXZSE Pq1҅#fdžfdžPWSV1MPh:9h^Q[E_PM Q1҅e[^_]áttxRR0h0ukRMGPhZh^QM %KMPhJ9h^Q~Phh Q \Ekt&UWVSEu} E@$H^PPEPGPPfdžfdž x  )ѨPxukPtPPSRP PPPLPTP\X1PS<QRf1󸉈QR1ųU RE.TR RUPHPhZh^RXEPW1҅fdžfdždžfdžt5)v{ t xuAfdžÉufdž%e[^_]Ðt&PjSVu1܋넍vKUPPh^RY[]SW 1҅y%눍&USP]xt]PjE PS}tǃx]Í&UWVS\E }(jxt e[^_]Ðt&uEE@t&E fLJLJxe[^_]ÍE;Ut BUPB4PC,@PC,Ph\h^V^S,J kJPhX9h^V7S,J8kPh_9h^VS0JkPB4PC0@PC0Ph8\h^VS0J kePhX9h^VS0J8k!Ph_9h^VSHkPK@QSDRC4Phg9h^V`kPCxPC|PClPh9h^V-SJ4 k:Ph9h^VCP$Phjh^VY^uVU R5É GC PSh9h^VC f@% *PCH8Qjx )PrZYPC@0PxPhX\h^V1S,JkQhB )P$ S,y@DPh9h^VPPhB4  )PPh )R XPh )R t&QQhB8 )PQQhB )Ph{QhB )PI S0!QQhB8 )P&QQhB )PEj4PPjff9tRUCPCPQRh9h^Vu E fLJE LJxxEj4PPj effbPPVU BPP‹ EfLJ%C US Sf9A&UWVSU (]xte[^_]Í}EhE@<Uttt2}x9dttG9duoEUt;AShx\h^h]QXZhSE P UEǀǀCvTUǂ} Eǀxe[^_]Íp$t]뺋}t;pt&hUYPxlpl^{ 9t+RVh9h^hP^t ;rhYg€\%tbl9h ZCZpG@p? tp;J1ҊOʡDP@uA<€  Шu€\ Шl9dh\1hȋSB SV U ch hXCX/h_h Bp@BM9WWhVM QK}xމt;XN\L\El9Zh\hhSZXËDxsh^XDȋhr^ZDret]ߋ4nPPWE @PPR ǃǃǃ}E|WWP|P謷t[^JMb)RMQUREPElPE`PEPh\h^hP1t0fz]j.St$Pj :Mt G PGPGt|R9tRtBdWBVJQSMdRPh\h^hPt@PPhWu V ]ǃtGh G@GpÉxHut G PGPGt|R9tRtBdWBVJQSMdRPh]Ѝ] j.SPjzM%fǁǁxvUhÐUWVS<1] utKt:EEEEtUfBfEڐt& jhPjjV t5EQjPVx 1҅ttR1ҍe[^_]ÍERjPVǴɃ jhPjjV詳 2 E܍UȉEfEj EREh ,fEjEVET @t Ej Ph ,jV8 @H@UBE jhPjjV Yt&UWVSE] Mۋu…%tE 1~te[^_]ERjjfF %P藵Ã9TPhjS@f jhPjjSA @H jhPjjS# @F jhPjjS Fr-P@ PF PS˲@WWuPS@F DC; ~ DDD DtDDUE…%u Ee[^_]PEPEPE PEEE_ S(EE4_EEd_놃 W*@$WjjS蛰 @EE_E jhPjjSh @p jhPjjSJ @REE_E=& jhHj jS E^EEE^EME^M&UWVS 1UB@z@`*t&PjjS ƃt`9u֍e[^_]ÍUMyt]ÉAǁǁ@] UMyt]ÉAǁ`ǁ@] UWVS } u FPPW8  t )ʅE‹XTt&uMVBT9tGCt: EPjVRCP5D ƒCxu1҈…t{ t,G4G8G4e[^_]ËFEqF0@@G4@@F\`F$pt@u F$1e[^_]Ë_8ۉuF@Pt tG81рPF$븸G8t&UWVSEEX;^l^%ME9MU_ZE8t#^E8E1ۋP %itֿX8PQE0PEP@Å9@tPPPhSCtH ^@pu^RQh_EP}W膭E VVjjMUP XQXPAXʃTEe[^_]ÐE9E*MxEP:tESjPRlE xQU RPMAPPh `EPEPĬE ;M%u#e[^_]1Bfp1BfUPh^})ω}uVEPb뵍 xQhURPMyW1Vh0EPEPe[^_]ËMYPuUEBP1 xQU RPMAPPhL`뙡 xS_ZUYWPM1Vh|`]SMQ~ xQU RPM9WqVh`븋M xVUZSMQPBPPh`냃 SUSh aoU xWM^Y SURPAPAPPh8aEPEP踪 SE8Wh aM xWFU[^J QMRPhxa&UE Ut@,u1]Ë@B |]Ðt&UWVSE tx,u 1[^_]Ëw_ A<€ ШnV?1C 1CE;uNC+11ҊS1҉E1CS1҉E1CS1҉E1CSЋUEÉ/]ƒ}%EUEЋ]B 9EE~x11ҊCS1҉E1CS}B=G_(؋O )ȃX9}9|EU@ |o]C X~1CE Uh$`t$0$,4ÐUVSu] 9t"u'tC @C Cu/e[^]ÉBJ I J udž빃 SЃƐt& RЃِt&UWVS uVEUt'F$@8S4FEF,@Tb^0CT@N,tp P JP tp x Ox ]EHtU싂H IH Exx:Ex4tGU싚t C tCP JP utU싂X K8X Et H IH Ut P JP Et x Ox V~9׋u AًBABR tA BQ J9׋uŋF]BF  0p Nۉp t Uz e[^_]ËU싚t C tCP JP uU싂H I8H v࿉F$FK$S4I҉K$C,t S/9C$ WT PS^0 P? P讽/CVQQjVpP p Qy<EZPi<X P]<X PQ<X=  WD<U^S4<UEe[^_]<'U     jhh:5:  %ÐUVSuF,tTPH@D+ t,FVdh9t dhuqF0tfPH@D+ t>FVlp9t lpttx[^]lp끍&'UWVS ] uC,K(C@A  up t^x )Ћ | MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QS01uC4CC01^'UWVS u} t F$@F HF uQF<@G_0uG0 Ge1[^_]ÅFt48듃࿉F$C$HC$F HF pO0t$(F,0tS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@&S4C,t S89C$s PaF$F$G0_4C6C,t Sַ9C$ QtCtVGOUWVS } uG,_(EF@unC(^{]Ft }| tZFV@r!tEQjW RUBL@ PYY*C4C(XC4{Wv,dž  E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$x )Ћ | Mb<))ʍe[^_]Ðt&C,@u kU CSS$SC0 C0 3] ue[^_]Cjx )Ћ | MbC<))ʍF,0 SS$SC,{0uC0 B Va\x L`L]9\A@AP;XXF@CCF$=p{{] ue[^_]LC,@u u F@x )ȋ |  )ѺMbC<)ʍSS$SC0$(S{0C0@{4tX\ x L`LM9JAJP;XvXt$(F,0tAW4ut0Gt*G,t Wò9G$s W SS$SC,x )Ћ | Mb<))ʍbuY)ƉHtHAEALJMM)Ht!BMBLY뺋EBލt&UMQ$u!AluA\`Q$]ÃtwQ$Q$ރt Q$΁Q$ÐUWVSEp@@0 ^,N0$E FDM F|d Vl\VN0 ^,CL8 CP8 ;E uU1UEptACL8v̀C4  %1ljptE K C4u u CL8 uC0t | gЉU% = ; E%=%`=@7 %` = `@ SP:u"t%=%VlBwf^lt&JFlQQPVVlu.tϋ@tF%tPPFlPVVlt^,E1ЩptECL8CP8EN0t&EM uE1؉EEptAALڃ8v΀y4~ F%1ÉptE A4u. u&AL8vA9A,sA, uA0= u;A0t4| t+9P~VFz@ E% = %`=@%` = `@GE1ЩptE^,CL8CP8U9Es` AP8 * F@t F$AP8^,CP8 N0F4F8FlFpFDFDF|F|f uCAS{}tUt )~}Qytхt )~EʅtUt )ȅ~ʋMQ4{4t[8҉t хEʉH4NHt˅t Љ)ȅ~ˋMډY4t˅t Љ)ȅ~ˋEX4Ee[^_]èC4C4C4C4C4,9PVFz@ unb UC9C, "C0=SK,)ʿ2C,7 *QY,)ڿ/A,C ! Vҡt_Vla SS$SC,C0uC0@Fl QQSVЃVlx )Ћ | MbFlEG))ʋMʺ V,N0nCP8F@ N0 E@C,a)A0A,)؅ib^lPPSV|~l^,{ PUj^,^ PAj>Vc[N0#PPSVt^,KPPSV  ^,PPSV9t^,!PPSVtЋ^,E@ APPPN0Y4 @V$p?0V$VXN0*PPQVQ<N0 ALPPN0F$pA4N$@N$VZXN0^,@)C0C,@_WWSVf^,t ALPPN0A APPPVlB ^lS$$F48t,0^,C45F0@4'F$pu@F$ F$V$p V$V0X^,C4 @Ѐ@ CLPP^, CPPP^,V$0V$dF$pC4N$ N$VX^, n fF$@t ࿉F$Z$KZ$QQjVFtAS4ut0Ct*{,t S9C$s Q^,S VF$ F$rF4j ^4SVL$VP$ ^,C4AF0@43F$pu F$ F$ F4P脧Fl$y^,¯uC  t )ȅ/uC  t )ȅuC8  t )ȅN0¯uA= t )/uA= t )0A8= )t~l ~4 N0^,CPHFIF$tFJ H `x )Ћ | Mb))ʍډVX|t+F$ u%F@tF,PH@D t V V}Ex t! Pg%U9u Mq$t4 ȃP7%MKQDMtt MP JP H1vt CLPP^,C CPPPzt0V$V$t)QF$F$t4F$@F$t@#0PPSV[ F$0ʃ 0GtWWCPf@ %PF,@Lf@ %PFSQhah@詊Ph@jɅ~8@PPfFx%PfF@%PFPWhah@GPh@jg~pPPfFx%PfF@%PFPPhah@Ph@jvUS E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]Éȋ@fG뱐UUM Ѓ ]ÍUU E 1]UU E 1]USUE у %t []Ít&'USU E t []UE]ÍUWVSE]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$eE @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEPD%Ðt&UEP]ÉUEPQP@ ]ÍUWVS u }PPWCP5pt9ue1[^_]Íe[^_]UWVSj(EPotu=tSu)E_t:QUsREPCP/ru CU<tCu΋?ue1[^_]Íe[^_]à EPq}r&USRË@tS u CPCs S7s]à P҃C Ps؍t&UWVS ǍX@09uG __uGHIHe[^_]à PrGHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjjIrEtU؉PJEAJMA AAAWWj(SmtV@EQQj)PmRRNjE)ǍGPjqÅPWEPSpE܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjj`]t) EEj Sh ,jP] 1@tЋ]x\]81҈ƒUUM Ѓ ]ÍUU E 1]UU E 1]USUE у %t []Ít&'USU E t []UE]ÍUWVS,E EE9E =U܉M}؉EԋU܋EMUEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Emu=@  1ۋ=PESPWYY^PES1^U;u%t1t&|u FU;u%uӍe[^_]ËEH E؃t|t؉ڃ t | lDZ FST Ju  E f1)ЅM )CM  SQ&'UVSTuP j[t\PPSj[t5PPSj[t e[^]à P[ P[1F8Ѝe[^]Í&US]Po[XPc[YRV[C8]U]ÍU  |)A  ǀ B4B8B,0<B$@;B(;B 8B7B8B 8B8B8B@8B8]ÐUSQ̀Ãv JWۉZ[]É'UMʃɋU B]!Í&'UWVSEE9E5UuU1ۋuǃuɋ9tR=tɃ̀ÃvSVۉ5u]EC]9E`[^_]Ít&'UV5SӋu%@ ؉[^]ÐUWVSSE] ƉEC<1uE ى Z[^_]Ít&'UWVSPE] ƉEC<1t!E'B`>B >B>B ?Bp?]ÐUSQ̀Ãv OۉZ[]É'UW=VSË4u+ Q ЉC[^_]ÍUW=VSËt3NH9t V Љ[^_]UEM ]%ƒ ЃÍ&'U1VSSS]5M tt#1^Z[^]Ð A 5M 11‹ Љ^Z[^]ÍUVSQQ1ҋ]5M t1u1m5M 11‹ Љ^Z[^]Í'USj]SjSy]Ít&US]R[]ÐUWVS,EE EEUE1HEMEСuЊ؃EE܅tHxsMЋ1 ؃d3E Q EME|]M EȋUܣ]}H9v@MM uu @ 1]9vUЋt9U}UЋ 9U~U UЉ̀E؃vK]؋UEPPEPW貜EM؃9M\E3vU1 u]F uM؉]9M ]ԡ  DEЍȃdttttD1=uЊ` D < ШV1D 4 V =U1 $ D< Ш1D  }WTu]F uM؃]9M E=1ҋE1Ш tq tu u}Ƀ]1Ҋ%tuЋ5̀Ãv IۉEI]MЋ |L EPT ]1Ҋ ЉV|-L EPuf ]1Ҋ Љ u1Ҋ Љ u1Ҋ ЉE5  Ef1)ȅE)ȍx v@e[^_]ãE Ee[^_]vUS]T@Tt9|n@RRPjJ tuPPTPjJtEPPTPjaJtЋ]Ðt&뎃 QQJ  R?J P>FC81҉Ћ]Ã*t&US]PIXPIX QIx PEC8] UPPT@1҅x PuEÐ&UPPx PMET@KÍ&'U  )A  ǀ B4B8B,MB$`LB(pMB FB0 NB`EBEBEB FB FBFBF]ÐU=iEhjj I‰tFEPh% hjRE u 1"t&5DÐU5CUEEPh% hj59EÍvU% ÉUj uhj5(EÉUj uhj5EÉUE=t =t!v55U0WV}辘g'C…uEPuDjFt&jEPRDEut1e^_ÐU)tu tj C1ÐUm5CFÐUEM BJh1ÐUSUM ]HXh1]ÐUWVSE} hjʉȻjtzt80t1@80t,@80t'@utttu߃@@)ȍp} tUE xtL؉ڃtzt80t1@80t,@80t'@utttu߃@@)؃1ƅt7t9rU BPSQh"jEPEGPQUR,EED8e[^_]UEPlЉ]U S]Eƒtt t@tjEPEPEPRE P+‰ECtjjReC1 Eg]]ÐUWVSu }UMEE@ |tE@|t1>t: wUU- P@EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQB9sUډ@C9r18}t MQBF w$,j p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1sEtq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸsL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿsL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$v~1ۊY!#E9t]υt=1A1ҊQ 9At1t1%뎉[^_]ÍvUWVS1]1O~PP$LwE PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1%`FW1C1ҊS ƃ>FC4M!1̓w3$x1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ T$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$xS!1C!̓w$y1BR Ѕ~1(jjj1PÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸kNju =kt3%9ujVPEPj9 uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$yEU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0Rk}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND${1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCS(T`MMT~`U(RjjTQtWTVP(`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Q)` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Q(` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPP&E`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#${EPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71Bs%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}s@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSP!# u @CRQ Vr$D;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPWw# t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM11s1ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$|E%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $}jE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$~H@vP@t<)u担87DžRt#sH@%u㋅8) PB<v?t { 5sB1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WhЉƃ؅uDžM ERCP~NF fF(ffVffNfF}tSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:VlЋU+M M}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$ ]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB PC MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh xU ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PhЉEupEEMP EPRQGUM$ ABLErLPjURMQEPURCPV u'EMA`Up9Rl]Ex`UH EPRQ1C1ҊS à ;AoEUB`Up9&RlM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE Dž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPhЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1ɈҝɣHA-Proxy version 1.3.22 2009/10/14Copyright 2000-2009 Willy Tarreau Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Default settings : maxconn = %d, maxpollevents = %d Usage : %s [-f ]* [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon -q quiet mode : don't display messages -c check mode : only check config files and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Error(s) found in configuration file : %s Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Fatal errors found in configuration. No polling mechanism available. Cannot load configuration file %s : too many configuration files (max %d). [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselectConfiguration file is valid %d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF}c\Invalid server name: '%s' Socket path '%s' too long (max %d) bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789:@O_k @ ( 3=GO@X@`kt ~splice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsindependant-streamsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerpersistredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootdescriptionpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledhealthenabledbind-processevenappsessioncaptureretriesblockunlessredirectlocationprefixuse_backendoptionhttplogtcplog(unknown)httpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForHELO localhost EHLOHELO%s %s headerHTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 default_backendredisphttp-checkmonitorfaildisable-on-404backlogfullconngracebalanceserversourceusesrccliexpreqrepclientclientipintefaceredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttrackreqdelreqdenyreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionrewriteindirectinsertnocachecaphdrclear-cookiepostonlycodedrop-querydomainrealmscopeenablehide-versionshow-nodeshow-deschdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d]: '%s' expects a string argument. parsing [%s:%d]: '%s' requires valid node name - non-empty string with digits(0-9), letters(A-Z, a-z), dot(.), hyphen(-) or underscode(_). parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionparsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. Parsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d]: custom id has to be > 1000. parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable', 'hide-version', 'show-node', 'show-desc'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d]: '%s' has to be > 0. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : invalid source port range %d-%d. parsing [%s:%d] : '%s' expects [:[-]], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d] : weight of server %s is not within 0 and 256 (%d). parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : status code %d not handled, error customization will be ignored. Maybe you want 'maxconn' instead ?parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots or does not start with a dot. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d] : '%s' expects 'code', 'prefix' or 'location' (was '%s'). parsing [%s:%d] : 'uri' needs an URI prefix. Maybe you want 'fullconn' instead ?parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: '%s %s' invalid node name - should be a stringwith digits(0-9), letters(A-Z, a-z), hyphen(-) or underscode(_). parsing [%s:%d]: out of memory. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). parsing [%s:%d]: '%s' requires a parameter or 'desc' to be set in the global section. parsing [%s:%d]: negation currently supported only for options. parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. config : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. config : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. config : HTTP proxy %s has a cookie but no server list ! config : '%s' will be ignored for %s '%s' (requires 'option httpchk'). config : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. config : %s '%s' cannot use both transparent and balance mode. config : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': loop detected for use_backend: '%s'. config : %s '%s' : fullconn is mandatory when minconn is set on a server. Proxy '%s': unable to find required use_backend: '%s'. config : %s '%s', server '%s': unable to use %s/%s fortracing: disable-on-404 option inconsistency. config : %s '%s', server '%s': unable to find required server '%s' for tracking. config : %s '%s', server '%s': unable to use %s/%s for tracing as it does not have checks enabled. config : servers will be ignored for %s '%s'. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. config : no line. Nothing to do ! config : %s '%s' cannot be in health mode as it has no frontend capability. config : log format ignored for %s '%s' since it has no log address. config : %s '%s', server '%s': unable to find required proxy '%s' for tracking. Proxy '%s': unable to find required setbe: '%s'. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled againCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPHTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Proxy %s stopped. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)timeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! config : cookie will be ignored for %s '%s' (needs 'mode http'). config : server regular expressions will be ignored for %s '%s' (needs 'mode http'). config : client regular expressions will be ignored for %s '%s' (needs 'mode http'). config : monitor-uri will be ignored for %s '%s' (needs 'mode http'). config : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. 6Unknown command. Please enter one of the following commands only : show info : report information about the running process show stat : report counters for each proxy and server show errors : report last request and response errors for each proxy show sess : report the list of current sessions %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket (%s). Aborting. Invalid empty name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket (%s). Aborting. error when trying to preserve previous UNIX socket (%s). Aborting. cannot change UNIX socket ownership (%s). Aborting. socket(): not enough free sockets for UNIX listener (%s). Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener (%s). Aborting. cannot listen to socket for UNIX listener (%s). Aborting. cannot switch final and temporary sockets for UNIX listener (%s). Aborting. cannot bind socket for UNIX listener (%s). Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE#HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. a1h!!!!!u^UnK` (sF/||HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession:calloc(). Not enough memory process_cli():asession_temp->sessid:calloc(). Not enough Memory process_cli():asession_temp->sessid:calloc(). Found Application Session without matching server. Not enough memory process_cli():asession:calloc(). Not enough memory process_cli():asession->sessid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valshdr_ippathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/srvrepsrvhdr; domain=%sCache-control: privateConnection: close: %d.%d.%d.%dclireqclihdr HTTP/1.0 : %s /Content-LengthExpect100-continueappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratefe_connbe_connavg_queuelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for server %s/%s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for server %s/%s. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓NOLBno checkDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,emptyOPENFULLSTOPactiveY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,%s

 text/plaintext/html on unlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max,
%s%s
%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,DOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy%s%s version 1.3.22, released 2009/10/14

HAProxy%s

Statistics Report for pid %d%s%s%s%s

> General process information

QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle
Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%lld%lld%s
Backend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%s

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits: memmax = %s%s; ulimit-n = %d
maxsock = %d; maxconn = %d; maxpipes = %d
current conns = %d; current pipes = %d/%d
Running tasks: %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.22 Release_date: 2009/10/14 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d node: %s description: %s rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: zCǸ@#Mk UD_ req_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentrejectresponse-onlylayer 7 (unexpected character '%c')cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparentacl '%s' involves some %s criteria which will be ignored.'%s %s' expects a positive delay in milliseconds, in %s '%s'ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sections'%s %s %s' only accepts 'if' or 'unless', in %s '%s' (was '%s')error detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_endbbkbbkbbkb/,kb/bkb/bkb/c ckc/ ckc/ckc/ ck%c/*ck0c/=ckHc/1kWc/eckgctcc.kc`^c.kcckkccccccc!=====c)CR"""-"y""parsing acl '%s' : matching '%s' for pattern '%s' is likely a mistake and probably not what you want. Maybe you need to remove the extraneous space before '('. If you are really sure this is not an error, please insert '--' between the match and the pattern to make this warning message disappear. Dumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%u bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splicetggggg      jiiiiiiidiPi?i1ii ihhhhmatch failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6dTTTTTTTTTTT:;<=>?@[\]^_` ~kxkrklkfk`kZkTkNkHkBk 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error UvUvUvUvUvUvUvUvUvU W W W W W W W W W W W W W W W W W WgU WgU W W W W W WgU W W W W W W W W W W W W WV W W W W W W W WgU W W W W W W W WgU W WUXXXXXXXXXXXXXXXsXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX@YzYzYzYzYYYYYYYYYYY ZzYzYzYzYzYYY Z Z Z Z Z Z Z Z ZY Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z ZY Z Z Z Z Z Z Z ZYY Z Z ZzY@Y@Y@Y@YdYdYdYdYzYYYzY Z ZzYY Z ZZZ Z ZYYo[o[o[o[o[o[o[o[o[o[o[s[s[s[s[s[o[o[o[s[s[o[o[s[s[s[s[o[s[s[o[o[s[s[s[s[o[s[s[o[o[s[s[s[s[o[s[s[s[s[s[s[s[s[A[A[s[s[s[s[[[[[s[s[o[o[s[s[X[X[_xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx`xxxn_ffxx:`xxxxxxxxxxxxxxxxgxxxxxxxxxxxxxxxxxxxxxxxxxxxv`vx_xxxxxxxxxxxxxxxxxxxxxxxxxxxxf_cc%ddccosnssssosssssss s s s s s s s s s sosoo"pssss1pssssssssssssps s}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}************************************************>*****************************@RRRRRRRRRR@@@L8-{$ ޓHH>aޝ@/Ofף^eeeeee11ااhhhhhh22Оyhhhe e  %1r/g*DUfw2T$\Ӯ7!! ߈و׈È     ypg\UOF=92*# ߇!ه"Ї#͇ʇLJć $   %& '}(r)f*`+X,VSPMJGDA;-96..&/# 0 123456݆7؆8І9dž:;<ZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;-.zR| (* (H+ p0bP@ -@<C`N$  $h( ` ԏ8o\oo *:JZjzʓړ *:JZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjz P'XX '.39>CHOT[_dintx|@00 @@"P "PP @@ @P     unix_streamnlpel` %&T&&/YpYY/0ZZ/0ZZ/@@[/[/[/[/[/[/[/[/"[P/@p\1]/]/]/]0] 0]0]0@^(0@_10"0aP/]/]/]/]0] 0]0]0@^'0@ `00"aP80a=0aF0aO0aX0aa0aj0a&'t(L)**+2@2@02@2@2@ 2@2@ 2@ f 77 7 88!8'838=8A8M8S8`^@ph^t^tcpv6  pelptcpv4pelpbPpbP0pcPpssss`s@ssrrYr rqqqeq@qqppppppap@ppoofo@o onnn`nGn nmmmm@m$mmllel@lttQedOdOP<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&-ic9-$-c$CODD$ c$JOcIDK$"c$RPcQDS$"d$p4PdoDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$pPDDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$PDDD!D(D7$;d$QDD $d$4Qdd DD DDDD+D/d@d@d@/$/e$dQdd #eDDDDDDD*D1d@d@.e@d@1$19e dQlibtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)P!6v9>: sIpO@KP`v 0@ /3JtyVb?Bs)PbY@t(x8Ap -c3Mj <}`lqOG0-&@@0I@1^N2VP7^7t<ODq է 0!6f+display_versionx+display_build_opts+usage+sig_soft_stop ,sig_pause3,sig_listen[,sig_dump_state,dump,init.deinit2run_poll_loopN2mains4global4progname4pid4relative_pid4trash4zero4one4nolinger5stopping75hostname!6UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)v9%a2base64base64tab8>:HI enable_listenern disable_listener enable_all_listeners disable_all_listeners unbind_listener( unbind_all_listeners^ delete_listener protocol_register protocol_unregister protocol_bind_all)protocol_unbind_all_protocol_enable_allprotocol_disable_allIstats_check_init_uri_authBstats_set_uristats_set_realmstats_set_flagZstats_set_nodestats_set_desc"stats_set_refreshdstats_add_auth,stats_add_scope_pO3V%ultoa_r%strlcpy2%ulltoh_rY&limit_r&str2sun'ishex/'invalid_charX'invalid_domainchar'str2sa)str2sa_range*str2net^,url2ip.-str2uic-url2saT.encode_string.str2uiM/strl2ui/strl2uic0strl2ic0strl2ircG1strl2llrc1parse_time_err_2my_strndupE3itoa_strg3hextab! init_bufferbuffer_writeZbuffer_write_chunkbuffer_replace/ buffer_replace2 buffer_insert_line2 chunk_printfT buffer_dump pool2_buffer-%'Alert'Warning(qfprintfS(get_log_level(get_log_facility(send_log1+tcp_sess_log,log_facilities-log_levels3-monthnameU-sess_term_condl-sess_fin_state+$__task_queue%__task_wakeupY%wake_expired_tasks'process_runnable_tasksy)init_task*nb_tasks*run_queue*run_queue_cur+nb_tasks_cur+niced_tasks++pool2_task=+last_timerN_tv_ms_cmp_tv_ms_addf_tv_ms_cmp2_tv_ms_le2X_tv_ms_remain/ _tv_ms_remain2 _tv_ms_elapsed _tv_add _tv_add_ifset- _tv_remain _tv_remain2 _tv_isle _tv_isgt tv_update_datehuman_timecurr_sec_mscurr_sec_ms_scalednow_msnowdatestart_date 1fd_deletedisable_pollerinit_pollers deinit_pollersD list_pollers fork_poller cur_poller nbpollers pollers+ fdtabC maxfdU totalconng actconnro Z get_pipe kill_pipe put_pipe pool2_pipe8 pipes_liveJ pipes_used\ pipes_freeR '$exp_replace%check_replace_string%chain_regex&pmatch/3k/warnifnotcap/warnif_rule_after_block 0warnif_rule_after_reqxxxe0warnif_rule_after_reqadd0warnif_rule_after_redirect1warnif_rule_after_use_backendm1warnif_misplaced_block1warnif_misplaced_reqxxx2warnif_misplaced_reqaddo2cfg_parse_global:init_default_instance[:cfg_parse_listen`creadcfgfilefcheck_config_validityhcfg_register_keywordshcfg_unregister_keywordsicfg_maxpconnjcfg_maxconnjsslv3_client_hello_pkt0I%$srv_downtime$srv_getinter/3,process_chk1start_checks'$srv_dynamic_maxconn$init_pendconn$pendconn_free1%pendconn_get_next_sessJ&process_srv_queue&pendconn_add'pool2_pendconn06+get_frt_addr.,event_accept V(3@(proxy_cap_stri(proxy_mode_str,findproxyb-findserver-proxy_cfg_ensure_no_http~.start_proxies>/soft_stop/pause_proxy/stop_proxy 0maintain_proxiest1pause_proxies1listen_proxies2proxy2next_pxid2listeners\8'uxst_add_listener*uxst_event_accept>-unix_sock_parse_request0uxst_req_analyser_statsB1uxst_process_session-8unix_sock_usage_msgD8unix_sock_usage?g.init_proto_http=/http_header_add_tail/http_header_add_tail2(0http_header_match20find_hdr_value_end0http_find_header21http_find_header43error_message4perform_http_redirect$5http_return_srv_errord5http_sess_log7capture_headers8http_parse_stsline9http_parse_reqline:http_msg_analyzer<http_capture_bad_message=stats_check_uri_auth>http_process_tarpit?http_process_request_bodyAcheck_response_for_cacheabilityAproduce_contentcBapply_filter_to_req_headers[Capply_filter_to_req_line(Dapply_filters_to_requestDmanage_server_side_cookiesFget_srv_from_appsessionGmanage_client_side_cookiesLJapply_filter_to_resp_headersCKapply_filter_to_sts_lineLapply_filters_to_responsexLdebug_hdrLprocess_responsePhttp_process_requesthdpool2_capturedpool2_requridhttp_is_ctldhttp_is_sepehttp_is_lwsehttp_is_spht5ehttp_is_crlfMehttp_is_tokeneehttp_is_ver_tokeneHTTP_200ehttp_200_chunkeHTTP_301fHTTP_302!fHTTP_3033fHTTP_401_fmtUfhttp_err_codesfhttp_err_chunksfhdr_encode_mapfurl_encode_mapfhttp_methodsUgsess_cookiemgsess_set_cookie)/'splice(stream_sock_shutr)stream_sock_readC+stream_sock_shutwi+stream_sock_write,stream_sock_data_finish-stream_sock_chk_rcv-stream_sock_chk_sndY`,~&appsession_task_init'appsession_init(appsession_refresh)match_str)destroy)appsession_cleanupW+pool2_appsessi+apools{+have_appsessionI(P+recalc_server_map-init_server_mapQ0fwrr_init_server_groups6fwlc_init_server_tree:7get_server_ph7get_server_ph_post8get_server_hh9assign_serverIAassign_server_addressBassign_server_and_queueEBconnect_server#Esrv_redispatch_connect^Fbe_downtimeFbackend_parse_balancewA'$stream_int_check_timeouts$stream_int_report_error%stream_int_return%stream_int_retnclosem5-print_csv_headerW-stats_dump_proxy.stats_dump_http/stats_dump_rawB0stats_dump_raw_to_bufferv0stats_dump_sess_to_buffer1stats_dump_errors_to_bufferc36,tcpv4_bind_socket.tcp_bind_listener.tcpv4_add_listener/tcpv6_add_listenerF/tcp_inspect_request%Mj4&sess_change_server'session_free1(init_sessionG(session_process_counters|(sess_update_st_con_tcp0)sess_update_st_cer)sess_establish*sess_update_stream_intp,sess_set_term_flags,process_sessionZ3default_srv_error|4pool2_session4sessions<Ahdr_idx_add&%signal_initL%signal_handlerq%signal_register%__signal_process_queuea&signal_queue_len&signal_state&signal_queue&blocked_sig`q<+acl_parse_nothingX+acl_fetch_nothing+acl_match_nothing+acl_match_str>,acl_match_reg,acl_match_beg,acl_match_end%-acl_match_sube.acl_match_dir.acl_match_dom.acl_match_int/acl_match_ip]/acl_parse_str/acl_parse_reg<0acl_parse_int,2acl_parse_dotted_ver4acl_parse_ip`4acl_register_keywords4acl_unregister_keywords4find_acl_by_name/5find_acl_kw06parse_acl_expr7prune_aclo7parse_acl7find_acl_default8prune_acl_cond9parse_acl_cond8:acl_exec_condH;cond_find_requiren<filt_cap<default_acl_listrG&$create_pool%pool_gc2f%pool_refill_alloc%pool_flush2%pool_destroy2&dump_poolsI&@read_freq_ctrifreq_ctr_remainnext_event_delay.Ifeb_deleteeb_insert_dupcN[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)V-check_cttproxy_versionOO__udivdi3է`O__umoddi36ղP0{0Ei  "0 #[@;e &tk 5int 60 >Em ?ER AE3 C Di; GPEro S UH  09 &-<5 &-i?'#/' #' #b ' #  '#'#O'# '#z'# '#$'#(+ '#,M'#00'$#4.'#8>'#<'#@'">#D '#{#FH'$*#Gb'(:#H'1#L'7/#Td'8/#X':#\!'<@#` / ' ' '#  '$# B '#< :  P 3oBTGQqFz #D #E# #F# $[ >   # #  + R # J #  +# ; wgy 6 7#w 8#2>40YgG ro  p# !ڰ# }# n ܓ# " # 7 =%kC%t %v# %x#hnh#ph#C"  - C#ref!h#0]4!w !x# !yC# !z0# !{0# L'!|0# r!}0# 8!~0# j?!0# -!0#$ u!0#( @ c bc# ss @ H#s#s# bit#u32"0* +y#key,#r H0wq1#rq2# 3#0 4#4 50#8 6#< 7/#@ 8#Dr)  R# # # [# C#: R# #|)8)J )K0# * )L0# {)M/#fd)N# j?)O0#exp)P0# 4)Q# c5)R# 4)S# u5)T#$ib)UJ #(ob)UJ #, x )V0#0 )W/#4J # )U j?"}0#rex"~#wex"#rto"# wto"#cto"#l"0#r"#w"# lr"#$ >"0#( "0#, "0#0 "0#4 H"#8 0)"3 #< "7#@ "7#A "b#D J"#L "#P "? #T "E #X y 0"tstr"u#len"v#  J  3 p "z *C# L*C# *# *#fe* #be* # *# j?*#$ Z *0#(req*J #,rep*J #0si*"#4 *# $*# *#srv*H# \*H# Q *H# > *"#txn*# *# * # *"# 2*"# # *‚# *Â# ,*m"# *0#y  9 V ] Tn  # ! # k auid ^f#gid _P#  `[# bux a  Lfd M# N# T O# > P# Q#  R# %$ S#  T0#  U#  VC# ) W# kA X# & Y# L Z/# [0#  b # ) c# T Q u m#  n# S o#  p# q# r#  s#$ 4 t#( 5 u#,  v#0  w#4 g x#8 , y#< h zC#@ e {#H  |C#L    8CfA#bBJ #.(?cbC# {D/# E7#evF7# G # H# I# J#$   J 8#get#put# u# s#E<_ L`/# c@a#setb#clrc# Ad# L@e#remf'#clog'# 4hD# 9iZ#$ Bjl#( $kZ#, GlZ#0 um#4 n#8 '>>-Z>Jl>` a ^/# _%# k`%#are+ ,# -# .# /#  /< h# A#;;/5-8len-90#cr-:0#-;0#N -Cv-D# 8-E# -F# )-G# m3-H# G",    D ,,l,ݔ#m_l,ޔ#u,ߔ#u_l,ߔ# v,#v_l,#,l,#v_l,#c,#c_l,# r,#r_l,#,rq,-st,D, P ,0#sol,#eol,#som,0# col,0#sov,0#eoh,0#cap,#sl,# ,b#8  ,#@<, 3,"# N,# ,P #req,#rsp,#\uri,# ,# ,# I,# j?,0#sE  &0# f 0# 0# g H?I JH# K# * L# M# N# O# B P# 'R # S# T#$ 5 T#( %$U0#, 6U0#0 tV#4 4 V#8 'W#< tXC#@ }!Y#H >[#L \\#\ ?^#l `#| oa# b# @dH# dH# e# o f# wg# h# i# ;i# #j# j# >j# k# l# Fm#ido# p0# b p0# q0# r0# us0# +t0# Vt0# gu# v # hwH# yt# yt# jz0# {q# }t# }t# ~t# ~t# t# .<# 0# t# t# t# Qt# U# 'lDR # # O# # T# r# # # B$#,aclC#0 C#8 C#@ C#H s>$#PsrvH#\ e #` ? #d h •%#h Y# Z # Ɣ# # Ȕ# 0# ʔ# g˔# [# ͔# R Δ# # Д# є# # G # RԔ# 7Ք# v-֨'# # ؔ# C# &&#id# 4+# tC# t# 4 # # 0# w0# 0# 0# <# 0# +<# 0# t# t# t# %$0# 0# `0# # z# # # # # 8# # 0# j0# q# t# t#t#t# t#t#) t#t#Qt##cap#\#? # #o #  #m ##u ##J{#{#### # #u##B#p ###Z#(#](## #]#(# (##w # #!&(#= "###$0# %0#F&Q$#:&Q$#HNH ; + + C# +! #srv+"H# !D* *# *|# *|# /*|# *# *#  *#$ k%*[#( } *[#, ,*[#0 *t#4 Q*t#<!*px*Ə #sv*H# *Ȃ# D*Ȃ# j?*0# iid*ʔ# I*ʔ#sid*ʔ#" * "*n#m"*iid*Д#px*я #buf*0#sid*0# ptr*Ԕ#bol*Ք#"*!((*˃!!*!!*" "  " "" "QI"6#acl$*$+C#u$,#B$-C#  $.#$/0#"#C$>$?C#g$@C#pol$A#$B0#-$C##p7!>4un5V in6#p2u7##Q$x ,| }H#t0~H#t1~H# 9 #  # # 0#$ #($ |#len0#pos0# sid0#srvH#oe #src#bufE #$be !u%  0# <C#E% srvE%# # #Hp%Xact##bck##,%actH#bckH#& # Q # # # # # 8 # H#map%# K%#, Vp%# T &# W7&# 8&# /&# &#&H&'  ۔# O3ܔ# 8ݔ# :ޔ# ?ߔ# # \# }!#'v-( #(# &)# *# +# 4++# 5,# j?-# -.d)# /)# 0'#$'(!   (# u # Z #len # H !# \E "#' &( 6(P #X(/$- $u.(@)*C#lD+(#be/6(# <#-)x(23C#lD4(#I5# 6#%7#8#j?90#:# ;#$d)  d)# # #-))  )# # G#j)).S C.O# .P# T.Q# .R# f+e .;uid.<#gid.=# .># %$.?# ,.@#  .A# !.B# a.C# .D# h.E#$ .F#( <.G#, '.H#0 .I#4 4+.I#8 J.J#< .J#@ .K#D .K#H .L#L  .L#P m .M##T u .M## .S)# .T # g.U#% PnU&+{pU'+(+)+C*__cB++8(U,u+ , U-sig.3, U-sig.[,  )U/sig., 0RU/sig0p V10sHS.,Y?`pU/sig>.j.9pǤU2W2+V0iS3p3'l4tmp3#h3d5i-3kS5-`0curI P3 JV3JS6-j.Sa(}.'.Sa(.(.(.6.j.ףݣ(}.'.ףݣ(.(.(.69.j.%(}.'.%(.(.(.'j.>D(}.'.>D(.(.(.7.n8m7. -8+8x+8,.11ФnU0p W0p0 P0h(S3D(V0sHV3cHp0lP3S3lD(S3/ (V0expS3P0acl6#S36#V3J1S3B 1V0rdr1S3C1V0uap'V0ua'l3"d)S0iS509jh5009jh5F09jh5\09j h5r09jh60#1(41'>1(O1'Y1(j1't1ĩ:1P601 :1Q'1Bt(1'1Mt(1't1MY(1X((;>1"*t;Y1*t;t1*t<1]=\1<1*tǂ;1 ~*t};1 v*tu>2 xpU/sigwV0pyS?F2 -U3t@F2A0AB93&0ղU22+ 0errV3}S3L'`3'93\520w|h5 30pxx S0retyP3 zV5$380ret2P1X3VP1C[&93CJ &93CL&93C~(Ls3y3 C(Ms3C4CC  C qC.v38CwC xC .\ 4D C/Q3E'> C0;C0<C1;0Fnow1<|C1>|CZ %Ge s)@G5nHpido GXpTCh.]GE @G& THonePG5H ;G  75 G'5 C5 2#C 3$C4#Cj 5CC Q0CR0C U0C VCW1IlI[m(IIInQC 00Ei @;kintErn#p#) R}#}#h#E# #:<< #N# H H< 0U ptr}Q h0S 'h oUG%S&NP i(hQ4pUG3Vp 3HS idx50P ~<~UG;RR;}W idx=0P >HS׳C%C% nJUGIpp IHW idxK0P LHS@PR%R%ftjS[UGZW i\0V ]HSxjgy 0;2UinQ=VoutS intr @E ( D  0Ei "%@;e&^kint6%>:m?:RA:3CDSErH %9 -5 -i? s#/ # #b #  # #O # #z #  #$ #(+ #,M #00 #4. s#8> s#< #@ "3#D #e#FH $#Gb (#H 1#L 7#Td 8#X :s#\! <#`    #  # B s#    3-n-#p-#o BT G Q$[3  _# #   R_# Jz# #  w    b  #  m   # # # bit s#u32"%* +##key,m# H0wq1x#rq2x# 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,|)8J K%# * L%# {M#fdNs# j?O%#expP%# 4Q# c5R# 4S# u5T#$ibUg#(obUg#, x V%#0 W#48g# U j?}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 0)#< ,#@ ,#A L#D J#L #P #T #X~~gp m  ] auid^I#gid_3# `># buxa LfdMs# Ns# TOs# >P# Q # Rs# %$Ss# T%# U # V# )W # kAX2# &Y # LZ# [%# b# )c# TQ um # ns# Sos# ps# q_# rT# ss#$ 4t #( 5u #, v/ #0 w/ #4 gx/ #8 ,y/ #< hz#@ e{s#H |#L ss s  / s  V  Cf A #b Bg# .( ?cb C # { D# E,#ev F,# G #  HT#  Is# J #$ 5 j   E< _ L `# c@ a #set b #clr c # A d # L@ e #rem f #clo g # 4 h # 9 i1 #$ B jC #( $ k1 #, G l1 #0 u m#4  ns#8 s s s      s  1 s ! C  7 n  iU  S r/pU . S >sU = P ? S HLs-U K P M S( *Zs0U Y S^ jsͷU i P k S 8xз U w Q !j|- 3U  P @_U  R"FT!j-)s`U  S#errsV_sU  S#errsV^sCU  S#errsV#sPU  S#errsV$[ $J $ q $. vV $ ws )% $Q X0X0Einti @;kEr #>#}# #>#G}#v-('#(>#&)}#*}#+}# 4++}#5,>#j?->#-.#/# 0#$<~U  <V uS p7 v4 2m  %%%}P@b *%*}P~@U  ?<uri?}S uASB}V #C> vS pQպ\LU  [< [} u]S^}V lC pj7ZaPwU  < k>P uɝRv U  u<W uu}P uwSWx}V  p"IU  <W 4+}P uS}V p ppdq¼U  < >P uR&HмU  < R} uםW}V %> >-S.&p =1 #% p`o % %нU <}VuW4 }Vg S pout'p%u#i%%|390#0El Bi "0@;e&tk2B5int60>Pm?PRAP3CDiEroS UH 02I40Y1G <xo pR#n "7 $Po BT G QqFz %D%E#%F#G 7  J G#  @ J$$[I_ +#_# o R+#J##  w!+#G#n ]#" # B d r\ s#I t # u# v#  w #6Tn  +#!#  k 9 -L5 - i?# / #  # b  # # # O# # z# #$ #( + #, M#0 0#4 .#8 >#< #@ "I#D #{#F H$#G b(#H 1#L 7/#T d8/#X :#\ !<#`/ # #B #Y  R  3 b#  E  # # # bit#u32"0y*+#key,E#n#p#y" - y#ref!#H H0wq1P#rq2P# 3#04#450#86^#< 7/#@8#DXXXH]4$w $xL#$yy#$z0#  ${0#L'$|0#r$}0#8$~0#j?$0# -$0#$u$#(  |)8J K0#* L0#{M/#fdN# j?O0#expP0#4Q#c5R#4S# u5T#$ibU< #(obU< #,x V0#0W/#4 < # Uj?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#80)% #< B#@B#Ab#DJ#L #P 1 #T7 #Xk 0tstru#lenv#| | <  % p zy#Ly# X# #fe#be## j?#$Z 0#(req< #,rep< #0si!#4 o#$o##srvP#\P#Q P#> !#txn# ##!#2!## #Í#,u!#0#k  + H ] { auid^#gid_#`# buxaH  LfdM# N#TO#>Po#  Q#R#%$S#T0#U#Vy#)W#kAX^#&Y#LZ/# [0#b{ #)c# TQum#n#So#p# q+# r # s#$4t#(5u#,v#0w#4gx#8,y#<hzy#@e{#H|y#L     CfA#bB< #l.(?cbCl#{D/# EB#evFB# Gd#H #I#  J#$ |  J8#get#put#u# {#|p 7> 46un 5jin 6p 2u 7#i) R###[# y#:d  "a"^/#"_%#k"`%#"aze!+!,#!-#!.#!/#   7< #I#CCi75(8len(90#cr(:0#(;0#N (Cv(D#8(E#(F#)(G#m3(H# O*'           D ' 'l'ݟ#m_l'ޟ#u'ߟ#u_l'ߟ# v'#v_l'# 'l'#v_l'#c'#c_l'# r'#r_l'#'rq'5st'D'P '0#sol'#eol'#som'0# col'0#sov'0#eoh'0#cap' #sl'#  'b#8 '#@D'3'*#N'# 'B #req'#rsp'#\uri'# '#'#I'#j?'0#{E &0#f 0#0# 1!P?IJP# K#* L#M# N# O#B P#'R#S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tXy#@}!YX#H>[#L\\#\?^#l`#|oa# b#@dP#dP#e#o f#wg#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#guP# v#hwP#yt#yt#jz0# {#}t#}t#~t#~t#t#.D# 0#t# t#t#Qt#U#'lDR# ]#O]# # T#r###B"#,acly#0y#8y#@y#Hs>"#PsrvP#\e #`? #dh ¤##hY#Z #Ɵ##ȟ#0#ʟ#g˟#[# ͟#R Ο##П#џ##G #Rԟ#7՟#v-$%##؟#y#&$#id#4+#ty#t#4 ##0#w0#0#0# D#0#+D# 0#t#t# t#%$0#0#`0#]#z]#]#]## #8##0#j0# #t#t# t# t# t# t# ) t# t# Qt# #cap# \# ? #  # o #  # m # u # J{# {# # # #  # # u# # B# p # # # Z# 0%# ]0%# t# t# ]t# 6%# 6%# # w #  # !F%# = "# ## $0# %0# F&`"# :&`"#HV; && y#&!| #srv&"P# D ## # /###  #$k%[#(} [#,,[#0t#4Qt#< !pxƗ#svP#ȍ#Dȍ# j?0# iidʟ#Iʟ#sidʟ# ! "ͤ# u!iidП#pxї#buf0#sid0# ptrԟ#bol՟#!((ˋ !! !  !| !!| !QI`"x ,|}#t0~#t1~#9### 0#$ #("#len0#pos0# sid0#srvP#oe#srco#buf7 #"beu !#  0#<y# T# srvT## # #P #Xact!#bck!#, #act#bck# $#Q # ## ##8 # P#map!## Z##,V##T $#W7$#8$#/$#$#$P$ % ۟#O3ܟ#8ݟ#:ޟ# ?ߟ# #\#}!#v-%! *% F% V%B "%<U#n;[Q$# ; $8;%pos=S"%,U#dst+R#src+S$8+Q&-V"Y&P 7U#nObVW$# O$8O&*QS& Rp"&r@hU#nq[Q$# qS$8qR#altqP"'{'pU#strzS%su|j&}P'y(__s/j"/'U#sR"X'u cU$uQ"'pU$uQ"((U#strS%sa϶p%cP&a#џV)g*1((__s/( 0IB(__uӝ((__cӂ+e((*,(-(*,(,(,(.(FL%__vIP'%he(P'/(n0m/( -0+0x+ 0,"*V(U#strW#lowP$P%sa%cS1p1V2**)3__s/4)5 05I5B3__u*3__c*_*6sepV+.*(BQ,(-(BQ,(,(,(-(QU,(-(QU,(,(,(.{*6__v#IP76he(P)8L,85CU9str4:>4L, :L4L,2g2e6c7V6s7W1m8S6len9[P*+03__s?/4m+?5 ?05?I5?B3__u?R,3__c?*+H3__s@/4+@5 @05@I5@B3__u@X,3__c@*,`6errJd-(,(;(P,(.5,6heX(P'+3__vO0]?++8-oP:U:>nV9dstnL,P1pl1ph6chpQ6tmpq-p6tpq(-W6cprd7x1 yBS'6new}P (-x x8-?0@gU9s--Db;-R7<-S<-Q=-=0>s(i0(j08T.,pXU9url:Q :>(1S6cpV6retR1Q10p'AE3__vI8.S`U:*Q:  :s9map.:sV'1R. 8)/B0'U9s-)/;:/Q7sڣ(i08/500YU9s9lenP-/13;/S;/Q7s>len(i08J00`U9s9lenP-J0df;\0S;f0Q7#<#@"V#D #}#FH$#Gb(#H1#L7#Td8#X:#\!<#`x 6   #  # B # 6  6 3n#p#]4w x}# y# zH# {H# L'|H# r}H# 8~H# j?H# -H#$ u#( 6  $[ V   # # 6 |)8J KH# * LH# {M#fdN# j?OH#expPH# 4Q# c5R# 4S# u5T#$ibUE#(obUE#, x VH#0 W#4E# U j?}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0 H#4 H#8 0)#< O#@ O#A d#D J#L #P #T #Xt0tstru#lenv#Ep t  6] Cf A#b BE#f.( ?cb Cf# { D# EO#ev FO# Gv#  H#  I# J#$ v  |@kU&pFUbuf%ESmsg%r len%Vmax'%2C2 buf EObufOU EP:UbufDES 0DVmaxFi%2pCK/ k@UbjESposj endjWstrjr!lVlenm ! UbESpos endVstrrlen!W >UbESposWstrrlen!VT 1>UchkV 8Sfmtr"#=$retP% R@Uo pbEW ^Stol&[ &J  &. v & w 6' & Q & ;H(  p -a$N00Ei "0@;e&ikint60>Em?ERAE3CD^~EroS UH 0oBTGQqF uz !D !E# !F#+iu9 - /5 - i?~# / #  # b  # # # O# # z# #$ #( + #, M~#0 0#4 .~#8 >~#< #@ ">#D #p#F H$#G b(#H 1#L 7#T d8#X :~#\ !<#`5   ~  ~#  # B ~#G@3Vtm,w 1x~# "y~# tz~# |{~# @|~# T}~# 8~~# l~# ~# #$ /#([ >    a# #  R a# J #  #w2>40YG  3o  p # x !a# # n # " x#7 b#   # # # bit~#u32"0 ?* +#key, # dnd#pd#? "  - ?#ref!d#  H0wq1#rq2# 3~#0 4~#4 50#8 6$#< 7#@ 8~#D ]4w x:# y?# z0# {0# L'|0# r}0# 8~0# j?0# -0#$ u#( |)8#J #K0# * #L0# {#M#fd#N~# j?#O0#exp#P0# 4#Q# c5#R# 4#S# u5#T#$ib#U #(ob#U #, x #V0#0 #W#4 # #U j? }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H ~#8 0) #< 7#@  7#A W#D J #L #P  #T #X 1 0 tstr u#len v~#B B  H  p  z "?# L"?# "# "#fe"f!#be"f!# "~# j?"~#$ Z "0#(req" #,rep" #0si"n##4 "# $"# "3#srv"# \"# Q "# > "~##txn"u# "~# "!# "## 2"## # "w# "w# ,"D## "0#1    ] 7 Tn  a# !7 #G kz auid ^6#gid _ #  `+# bux aG Lfd M~# N~# T O~# > P# Q#  R~# %$ S~#  T0#  U#  V?# ) W# kA X$# & Y# L Z# [0#  bz # ) c#  T Q u m#  n~# S o~#  p~# qa# rV#  s~#$ 4 t#( 5 u#,  v#0  w#4 g x#8 , y#< h z?#@ e {~#H  |?#L  ~~~~CfA#bB # k.(?cbCk# {D# E7#evF7# G{# HV# I~# J#${l  J 8~#get~#put~# u~# J# ~p7>4lun5 in63 p2u7#a'S C'O~# 'P~# T'Q~# 'R~# e ';uid'<~#gid'=~# '>~# %$'?~# ,'@~#  'A~# !'B~# a'C~# 'D~# h'E~#$ 'F~#( <'G#, ''H#0 'I#4 4+'I#8 J'J~#< 'J~#@ 'K~#D 'K~#H 'L~#L  'L~#P m 'M#T u 'M# 'S # 'T # g'U~# 2)  R# # ~# P# ?#:*v a ^# _%# k`%#aC e+ ,# -# .~# //#  v < d# #  2 W5&8len&90#cr&:0#&;0# N &Cv&D# 8&Ew# &Fw# )&Gw# m3&Hw#  %!!!! ! !!!! ! D %U%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%U oD% P %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%o#sl%# %W#8  %~#@ % 3%# N%W# % #req%#rsp%#\uri%# %# %# I%~# j?%0# JE  &0# f 0# 0#Y"? I  J# K~# * L~#  M~#  N~# O# B P# ' Rf!#  S~#  T~#$ 5 T~#( %$ U0#, 6 U0#0 t V~#4 4 V~#8 ' W~#< t X?#@ }! Y#H > [3#L \ \3#\ ? ^3#l  `~#| o a# b# @ d#  d#  e# o f3# w gw#  h~#  i~# ; i~# # j~# j~# > j~#  k~#  l~# F m~#id o#  p0# b p0# q0#  r0# u s0# + t0# V t0# g u# vl!# h w#  yi# yi# j z0# {A#  }i#  }i#  ~i#  ~i#  i# . # 0#  i# i#  i# Q i# U ~#Yf!'lD R  # # O # ~# T ~# r ~#  ~#  3# B $#,acl ?#0  ?#8  ?#@  ?#H s> $#Psrv #\ e ~#` ? ~#d h s%#h Y # Z #  ~#  #  ~#  0#  ~# g ~# [ # ~# R ~#  #  ~#  ~#  # G # R ~# 7 ~# v- &#  #  ~#  ?# & t&#id # 4+ # t ?# t ~# 4 ~#  ~#  0# w 0#  0#  0# #  0# + # 0#  i#  i# i# %$ 0#  0# ` 0#  # z #  #  #  # ~# 8 #  ~# 0# j 0# A#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# \ 3# ? 3#  ~# o #  f!# m # u # J p#  p#  ~#  ~#  ~#  ~# ~# u ~#  ~# B ~# p #  #  ~# Z ~#  &# ] &#  =#  =# ] =#  '# '#  ~# w #  ~#  !'# = "~#  #~#  $0# %0# F &/$# : &/$#H% !; $ $ ?# $!B #srv$"# Z"D" "~# "L# "L# /"L# "# "#  "#$ k%"P#( } "P#, ,"P#0 "i#4 Q"i#<""px"f!#sv"# "w# D"w# j?"0# iid"~# I"~#sid"~#" " ""j#D#"iid"~#px"f!#buf"0#sid"0# ptr"~#bol"~#n#"(("Z"""""~#r!#B ##B #QI /$x , |  }#t0 ~#t1 ~# 9 l!#  l!#  ~# 0 ~#$  ~#($  L#len 0#pos 0# sid 0#srv #oe f!#src #buf #$ be f!u $  0# < ?##% srv #%# ~# ~#N%X act ##bck ##,s% act #bck #b&  ~# Q ~# ~#  ~#  ~#  ~# 8 ~# #map $#  )%#, V N%# T n&# W7 n&# 8 n&# / n&#  n&#n&b&&  ~# O3 ~# 8 ~# : ~# ? ~# ~# \ ~# }! ~#v-&! &' %' #'>U$fmt=/%&?'tm@H(')'D)'P*'"+now!'+tm!' A#(dSU$fmtR/%&T'tmUH('$;)'D)'P#M(gU$outfM(S$fmtf/ %&h,(v~U$levu/V-w~S.&z%&z%,(~EU$fac/V-~S.%8&%&%#*~P[U$pf!V/~ /b-/S%-~ -~$-(&-*-l-~~-~P-c~-)*----~W-t~-\S0^*- +P- ~R-S1*2 +V22~P(+}3%+.['tm(')')'P*+++ 41+~5 +6,,G@`NU7s?B S8pnA8feBf!V8beCf!~9Df!2E~W2E~~8errE~~2F~8tmG~:+')'~)'P1,NY;__vj>.$;__vi><[M(pid'Z~<& '_,/?",-/?,-3-/ ?1#-`U-5?6g- E-?7~- E-+"P0p 0Ei "0@;e&ik27int60>Em?ERAE3CD^EroS UH 0oBTGQqFpz "D"E#"F#    b#  p  x### bit#u32"0'*+#key,#LnL#pL#'{" - '#ref!L#]4!w !x#!y'#!z0#  !{0#L'!|0#r!}0#8!~0#j?!0# -!0#$u!#( * 02>40Y5G @|o pV#$[> ##  R#J##  wW!ڇ#K#n a#" W# g7 9 -r5 -i? #/ # #b #  # #O # #z #  #$ #(+ #,M C#00 I#4. #8> #< #@ ">#D #p#FH $O#Gb (_#H 1#L 7#Td 8#X :#\! <e#` C  C# I#B # r _  u 3 H0wq1#rq2# 3#04#450#86#< 7#@8#Du|)8 J K0#* L0#{ M#fd N# j? O0#exp P0#4 Q#c5 R#4 S# u5 T#$ib U; #(ob U; #,x V0#0 W#4 ; #  Uj? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #80) $ #< 7#@ 7#A W#DJ #L #P  0 #T 6 #Xj 0 tstr u#len v#{ { ;  $ p  z '#L '# # #fe #be # # j? #$Z 0#(req ; #,rep ; #0si #4 #$ # #srv S#\ S#Q S#> #txn # # # #2 ## ‚# Â#, x # 0#j  * G ]p Tn  #!p # k auid^1#gid_#`&# buxa  LfdM# N#TO#>P#  Q #R#%$S#T0#U #V'#)W #kAX#&Y #LZ# [0#b #)c# TQum #n#So#p# q# r|# s#$4t #(5u #,v#0w#4gx#8,y#<hz'#@e{#H|'#L       ) Cf A #b B; #.( ?cb C#{ D# E7#ev F7# G# H|# I#  J #$     J8#get#put#u# ~#f) R###P# '#:{ a^#_%#k`%#awe+,#-#.#/*# 4< L#F#@@f45%8len%90#cr%:0#%;0#N %Cv%D#8%E#%F#)%G#m3%H# L'$    D $$l$݉#m_l$މ#u$߉#u_l$߉# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$#$rq$2st$D$P $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$ڣ#sl$#  $W#8 $#@G$3$'#N$# $A #req$#rsp$#\uri$# $#$#I$#j?$0#~E &0#f 0#0# 5 S?IJS# K#* L#M# N# O#B P#'R#S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tX'#@}!Y#H>[#L\\#\?^#l`#|oa# b #@dS#dS#e#o f#wg#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# v#hwS#yi#yi#jz0# {<#}i#}i#~i#~i#i#.G# 0#i# i#i#Qi#U#'lDR # a#Oa# # T#r###B""#,acl'#0'#8'#@'#Hs>@"#PsrvS#\e #`? #dh "#hY#Z #Ɖ##ȉ#0#ʉ#gˉ#[# ͉#R Ή##Љ#щ# #G #Rԉ#7Չ#v-h$##؉#'#&##id#4+#t'#t#4 ##0#w0#0#0# G#0#+G# 0#i#i# i#%$0#0#`0#a#za#a#a## #8##0#j0# <#i#i#i#i# i#i#) i#i#Qi## cap#\#? # #o # #m !#u !#Jp#p#### # #u##B#p ###Z#t$#]t$#q# q#]q#z$# z$##w # #!$#= "###$0# %0#F&!#:&!#HYx; ## '##!{ #srv#"S# D  # G# G# / G# # #  #$k% P#(} P#,, P#0 i#4Q i#<  px ƚ#sv S# Ȃ#D Ȃ# j? 0# iid ʉ#I ʉ#sid ʉ# " R#x  iid Љ#px њ#buf 0#sid 0# ptr ԉ#bol Չ#  !(( ˎ!  !    {   {  QI!p7!>4un5G in6)!p2u7 #!x ,|}x#t0~x#t1~x#9### 0#$ #(""G#len0#pos0# sid0#srvS#oe#src#buf6 #@"be!ue"  0#<'#" srv"# # #S"Xact)!#bck)!#,"actx#bckx###Q # ## ##8 # S#mape"# "#,V"#T ##W7##8##/#####S#b$ ۉ#O3܉#8݉#:މ# ?߉# #\#}!#v-b$! n$ $ $A "$>TPU# SS$$cx%$$%cl% %&% v'tu(%])\%*Y%0tU+t/S,-5P"&{U#z V- |W.eb}%S/%&%&0&P/%&%&$&%'$'0('P%4'/M&A' %R'$^' %p'1 2|'P$'0('P%4'/w&$  %$$%  % %/&'!5%'0'P$'r%'%'&&,_'t1^'t2^&&7%) 63'6'4 53A''4*4,F0&^'C%)B%3'T'4S'5tU&'{k)j'nowj&'h'tg'fg0")RU# .tS.eb%V-0W-‰p/(A'J%R'$^'J%p'1J2|'P$'8G0('P%4'/()JP%0)$%JP0 %P/(:)%G)/(S)%d)%n)$&-%&$&-%'$'-0('P%4'&:)'t(S)@) &y)'t1't26M*K`U7)fz5__s8)9 09>975__uM*5__cw,05__s83*9 09>975__uS*5__cw)*:[f*g:J f*:. v*): w *; :&Q*:';0h#< o#@ "3#D #Z#F H$.#G b(>#H 1#L 7#T d8#X :h#\ !<D#` " "# (#B h#Q >  T 3"|)8J K%#* L%#{M# fdNh# j?O%# expP%#4Q4#c5R4#4S4# u5T4#$ ibU#( obU#,x V%#0W#4..T"# Uj? }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#80) #< ,#@ ,#A A#DJ .#L .#P  #T #X:p   ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    -hKUtv1,Qtv2,Shtv1tv2`r`PUtv`S^ mshQ&6hUtv15Qtv25R%htv1tv2-AhpUtv1@Vtv2@W-)?KX*htv1)tv2)*K:pUtv1JVtv2JS|  H!" )[:tv1Ztv2Z/ J:tv1Itv2I"retK: U:,Utv1TWtv2TS '  #'!"  a:0jUtv1`Stv2`R;W  h$" Pb i`pUtvh`V^hRinchPb ~t    w`tvv`%^vincv [rhUtvq`S^qVincqQ    - Zhtv`%^inc {`dUtv1zRtv2zPtvz`V )    `tv1tv2tv`U N`pUtv1Stv2Rtv`QA U }g s         M`tv1tv2tv` }o`tvn` h Utv1Qtv2R    htv1tv2k h PUtv1Qtv2Rk )7|   htv1tv2&uPUihSh 'CФ'p'h(()b rt   Euauhtv1tv2x`tvx`8&UthS aQ)rvؤ)p͓p)cnthl ' *[4F*J 4*.vT*wh x+ * Qg,% ,% ,% -nowx , ,  ,1000Ei @;e &^kint3 C DSErH  09 -a5 -i?s#/ # #b  #  ##O# #z# #$#(+ #,M#00#4.s#8>s#<z#@">#D #e#FH$#Gb(#H1#L7#Td8#X:s#\!<#`g   #  # B s#s  l  3[ >   # # + 2>|)8 J K0# * L0# { M#fd Ns# j? O0#exp P0# 4 Q# c5 R# 4 S# u5 T#$ib Ue#(ob Ue#, x V0#0  W#46e#  U j? }0#rex ~s#wex s#rto s# wto s#cto s#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H s#8 0) #< 7#@  7#A L#D J #L #P  #T #X||ep k  ]ssCfA#bBe#].(?cbC]# {D# E7#evF7# Gm# H# Is# J#$ m  J 8s#gets#puts# us# "#sE<_ L`# c@a#setb#clrc# Ad# L@e#remf#clog# 4h# 9i #$ Bj#( $k #, Gl #0 uma#4 ns#8ss ss s 1+qn&0Ufd%sWqCO~QSL/].a#.s=4JU3ap5sV, 8% 8%! zAsPUpBsQbpCV"D xZU#bp\p]sV$ lsUoutk pmsS%)nsh%nsW%K7ospbppl&s1U'[ 'J  (   (ds   (  (.= (s ( s ( s  ) 'Qy k 0@0Ei  "%@;kint 6% >:m ?:R A:hEr % oBTGQz $  n $# p $# ]4w x# y# z%# {%# L'|%# r}%# 8~%# j?%# -%#$ u#(  23 4%YG  o  p#[3 T   # T#d  R # Jo# #w  ! # # n # " #, )Tn  # !)#9k ap7 >4+un5in6 zp2 u79# b#z ### bith#u32"% 1* +# key,#  H0 wq1# rq2# 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _#  `#  bux a  L fd Mh# Nh# T Oh# > Pd# Q#  Rh# %$ Sh#  T%#  U#  V# ) W# kA X# & Y$# L Z# [%#  b# ) c#  T Q u m*#  nh# S oh#  ph# q # r#  sh#$ 4 t#( 5 u#,  vJ#0  wJ#4 g xJ#8 , yJ#< h z#@ e {h#H  |#Lhhh:Jh:S COh# Ph# TQh# Rh#  e ; uidh# %$?h# ,@h#  Ah# !Bh# aCh# Dh# hEh#$ Fh#( <G#, 'H#0 I#4 4+I#8 JJh#< Jh#@ Kh#D Kh#H Lh#L  Lh#P m Ma#T u Ma# SP# T# gUh# T   h# J!h# "h# #T #   &T @Uret'T (p__p5S IVUpHT S V`UpUT R dU !"e X#2 *#T #h#h'30N0Ei "0@;e&ik5int60>Em?ERAE3CD^EroS UH 0oBTGQqFpz !D!E#!F#|  a^#_%#k`%#aze jh#_i#Cj?e+,?#-E#.#/v# K 2>40YPG [o pq#$[> ##  R#J## - wr!ڢ#f#n |#" r# 7 9 - 5 - i?# / #  # b  # # # O# # z# #$ #( + #, Md#0 0j#4 .#8 >#< #@ ">#D #p#F H$p#G b(#H 1#L 7#T d8#X :#\ !<#`d d# j#B #-  &  3 b#    # # # bit#u32"0M*+#key,#r n r#p r#M" - M#ref !r# H0wq1$#rq2$# 3#04#450#862#< 7#@8#D,,,]4 w x # yM# z0#  {0#L' |0#r }0#8 ~0#j? 0# - 0#$u #(  |)8 J K0#* L0#{ M#fd N# j? O0#exp P0#4 Q#c5 R#4 S# u5 T#$ib U #(ob U #,x V0#0 W#4 #  Uj? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #80) #< 7#@ 7#A W#DJ #L #P   #T #X? 0 tstr u#len v#P P  V  p  z M#L M# ,# #fe #be # # j? #$Z 0#(req  #,rep  #0si !#4 #$ # -#srv #\ #Q #> .!#txn %# # Y# @!#2 W!## w# w#, # 0#?    ]E Tn  #!E # U k auid^1#gid_#`&# buxaU  LfdM# N#TO#>P#  Q#R#%$S#T0#U#VM#)W#kAX2#&Yp#LZ# [0#b #)c# TQum#n#So#p# q# r# s#$4t#(5u#,v#0w#4gx#8,y#<hzM#@e{#H|M#L      Cf A#b B #s.( ?cb Cs#{ D# E7#ev F7# G# H# I#  J#$    J8#get#put#u# # p7>4un5 in6-#p2u7#v) R###P# M#:#8< r##v5$8len$90#cr$:0#$;0#XN $Cv$DX#8$Ew#$Fw#)$Gw#m3$Hw# #           D #^ #l#݉#m_l#މ#u#߉#u_l#߉# v##v_l## \#l##v_l##c##c_l## r##r_l##y#rq#st#D#P #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap##sl#\#  #W#8 ##@#3##N## # #req#y#rsp#y#\uri## ####I##j?#0#E &0#f 0#0# P!?IJ# K#* L#M# N# O#B P#'R#S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tXM#@}!Y,#H>[-#L\\-#\?^-#l`#|oa# b#@d#d#e#o f-#wgw#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu$# v#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U# 'lDR# |#O|# # T#r##-#B]"#,aclM#0M#8M#@M#Hs>{"#Psrv#\e #`? #dh ###hY#Z #Ɖ##ȉ#0#ʉ#gˉ#[# ͉#R Ή##Љ#щ#҇#G #Rԉ#7Չ#v-֣$##؉#M#&$$#id#4+#tM#t#4 ##0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0#|#z|#|#|## #8##0#j0# <#i#i# i# i# i# i# ) i# i# Qi# #cap# \-# ? -#  # o #  # m  # u  # Jp# p# # # #  # # u# # B# p ?# ?# # Z# $# ]$# # # ]# $# $# # w #  # !$# = "# ## $0# %0# F&!# :&!#HY; "" M#"!P #srv""# D  # G# G# / G# # #  #$k% P#(} P#,, P#0 i#4Q i#<  px #sv # w#D w# j? 0# iid ʉ#I ʉ#sid ʉ# " x#  iid Љ#px #buf 0#sid 0# ptr ԉ#bol Չ#! ((  ΁  ֘ .! "@!P 4!W!P F!QI!x ,|}#t0~#t1~#9### 0#$ #(]"G#len0#pos0# sid0#srv#oe#src#buf #{"beu "  0#<M# " srv"# # # "Xactd!#bckd!#, ##act#bck# $#Q # ## ##8 # #map"# "#,V"#T $#W7$#8$#/$#$#$$ $ ۉ#O3܉#8݉#:މ# ?߉# #\#}!#v-$! $ $ $ "%U#dstW#src #strvV$%%p&\%+`'len#S'num#P(%Z/7Q%>/7P&%lv),2(),3% "%eEv=U#strDvS'errFvV"Z&2fv@U$bdZ&S$dER$eR$evV*expg?+O_'errjvP?,.Km&s& >,~L&& ~,M& & -&` ,[&,J &,. v&, w '. ,%Q&k880k 0Ei  "0 #[@! %m;e &k 5int 60 =b >Em ?Ek! @PR AE BE3 C DtEro S U l$ qH  09 *-s5 *-i?+#/+ #+ #b + #  +#+#O+# +#z+# +#$+#(+ +#,M+`#00+f#4.+#8>+#<+#@+">#D +##FH+$l#Gb+(|#H+1P#L+7f#Td+8f#X+:#\!+<#`  7 f +` + +`#  +f# B +#)s | "  3oBTGQqF$z $D $E$# $F/#2>40YG .o  p#$[[ >m  9# m# }   R9# J# #  w  !9# # n # "  # 7 rr \s# It# u# v# w#D %3 %4# G%5# %6# %7# 3 %8# %9# !%:#,}', '-#  '.# s!'/# '0# Q!X)% )&# )'># [!))# )-# 6).# )/# c)0# )1# d)2>#( /)4#, <)8:#0 $!);E#4 b!)?$#8 !)@[#< )A$#@ !)B[#D )C$#H ?)D[#L !)F[#P I)G[#Tt bt#  Q Y### bit#u32 "0 *  +#key ,#- n -#p -#\"  - #ref !-# H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7f#@  8#D\ ]4"w "x# "y# "z0# "{0# L'"|0# r"}0# 8"~0# j?"0# -"0#$ u" #(   j |)8-J -K0# * -L0# {-Mf#fd-N# j?-O0#exp-P0# 4-Q| # c5-R| # 4-S| # u5-T| #$ib-U #(ob-U #, x -V0#0 -Wf#4v v  j  # -U j?#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$ >#0#( #0#, #0#0 #0#4 H##8 0)# #< #7#@ #7#A #m#D J#v #L #v #P # #T # #X  0#tstr#u#len#v#     p #z .# L.# .# .P#fe.#!#be.#!# .# j?.#$ Z .0#(req. #,rep. #0si.+##4 .}# $.}# .#srv.# \.# Q .# > .;##txn.2# .# .f!# .M## 2.d## # .# .Í# ,.## .0#   ]Tn  9# !#  kC auid^#gid_# `#V buxa] LfdM# N# TO# >P}# QJ# R# %$S# T0# UP# V# )Wf# kAX# &Yl# LZf# [0# bC# )c#J TQ umr# n# So# p# q9# r.# s#$ 4tf#( 5uf#, v#0 w#4 gx#8 ,y#< hz#@ e{#H |#L]VfV  JCfAf#bB #4.(?cbC4# {Df# E7#evF7# Gr# H.# I# J#$ D  J 8#get#put# u# #D )  R# # # [# #:9 a ^f# _%# k`%#ae+ ,# -# .# /# D 9< -# #518len190#cr1:0#1;0#kN 1Cv1Dk# 81E# 1F# )1G# m31H# 0    D 0q0l0ݟ#m_l0ޟ#u0ߟ#u_l0ߟ# v0#v_l0#o0l0#v_l0#c0#c_l0# r0#r_l0#0rq0st02D0 P 00#sol0#eol0#som00# col00#sov00#eoh00#cap0#sl0o# 0m#8  0#@0 30# N0# 0 #req0#rsp0#\uri0# 0# 0# I0# j?00#E  &0# f 0# 0#  ?I J# K# * L# M# N# O# B P# 'R#!# S# T#$ 5 T#( %$U0#, 6U0#0 tV#4 4 V#8 'W#< tX#@ }!Y#H >[#L \\#\ ?^#l `#| oa# b# @d# d# e# o f# wg# h# i# ;i# #j# j# >j# k# l# Fm#ido# p0# b p0# q0# r0# us0# +t0# Vt0# gu# v)!# hw# y# y# jz0# {# }# }# ~# ~# # .# 0# # # # Q# U##!'lDR P# # O# # T# r# # # Bi%#,acl#0 #8 #@ #H s>%#Psrv#\ e #` ? #d h /&#h Y# Z # Ɵ# # ȟ# 0# ʟ# g˟# [# ͟# R Ο# # П# џ# Қ# G # Rԟ# 7՟# v-B(# # ؟# # &0'#id# 4+# t# t# 4 # # 0# w0# 0# 0# # 0# +# 0# # # # %$0# 0# `0# # z# # # # # 8# # 0# j0# # # ### ##) ##Q##cap#\#? # #o # #!#m W$#u W$#J##### # #u##B#p ###Z#(#](## #]#(# (##w # #!(#= "###$0# %0#F&$#:&$#HYf!; / / # /! #srv/"# "D. .# .# .# /.# .# .#  .#$ k%.[#( } .[#, ,.[#0 .#4 Q.#<".px.#!#sv.# .ȍ# D.ȍ# j?.0# iid.ʟ# I.ʟ#sid.ʟ#" . ".3##.iid.П#px.#!#buf.0#sid.0# ptr.ԟ#bol.՟#+#.!((."!.Ύ"!.֥" ;# /!M# A#d# v S#9QI"#acl(*(+#u(,#B(-#  (.#(/0#w#/$C(>(?#g(@#pol(A#(B0#-(C#W$p7!>4Dun5 in6p$p2u7/$#$x ,| }Y#t0~Y#t1~Y# 9)!# )!# # 0#$ #(i% #len0#pos0# sid0#srv#oe#!#src}#buf #%be#!!u%  0# <#% srv%# # # &Xactp$#bckp$#,/&actY#bckY#' # Q # # # # # 8 # #map%# %#, V &# T *'# W7*'# 8*'# /*'# *'#*'''  ۟# O3ܟ# 8ݟ# :ޟ# ?ߟ# # \# }!#B(v-( #(# &)# *# +# 4++# 5,# j?-# -.*# /*# 0B(#$'(!  !(# u!# Z!#len! # H!!# \E!"#H( (  ( #(/$-#!$u.,)@)*#lD+,)#be/(# #)x(23#lD4,)#I5# 6#%7#8#j?90#:# ;#$) &$ &%#kw&&# &-&*#&*#!#!)T* &5 &6#kw&7T*# c*) *  *# # #c**  *# # G#*+4S C4O# 4P# T4Q# 4R# ,e 4;uid4<#gid4=# 4># %$4?# ,4@#  4A# !4B# a4C# 4D# h4E#$ 4F#( <4G#, '4H#0 4I#4 4+4I#8 J4J#< 4J#@ 4K#D 4K#H 4L#L  4L#P m 4MW$#T u 4MW$# 4S*# 4TV# g4U#, U uV#valW0#capX0# 'Y0# %. PU&str~'m3PV(lPP(cP)~)]S)~)a#S(endW*" L+|.(ss}~,-=T-__sf.-./.0./././..../.0./././..I../.0./././.,d.(__v>P1EK(__v>P+.-__sf2(he.P3.n4m3. -4+4x+4,5/ FU6'#!V7capQ6*6-7arg68msg S0/ //9/ 2:'1#!5 0<  PU6'#!P6* 6-7arg5e0-U6',#!P6*, 6-,7arg,50 :U6'9#!P6*9 6-97arg951!GAU6'F#!P6*F 6-F7argF5m1TPU6'S#!P6*S 6-S7argS51_ U6'^#!6*^W6-^V7arg^S52"hxU6'g#!6*gW6-gV7arggS5o2pU6'o#!6*oW6-oV7argoS59[ U6*6 ! 6>7inv;~K=%=%.F7.kz/.0.kz/././.,l7=%=%.7./.0./././.,7)=%%=%%.7.FU/.0.FU/././., 8_l=2%=2%,F8=?%=?%+v88i@V8len@S8dAS,8=V%=V%+88iWV8cXQ,8Ub=m%=m%,.9=z%=z%1=z;zP+r9;{W$~;|S;|V;|W,9=%=%.9.4C/.0.4C/././.1=%=%x,*>B:l U+.:8?__sf0B:D/O:@[:j8:'7#!5b aU6* 6 !  6> 7inv ;Q#!;!S8errP8rc}8val0~;~;P=%=%,d;=%=%,;`=<%=<%.;///.;B:`j/O:.;bAb~Ab},<  =%=%,(<  =%=%+J<p=%=%,p<  =%=%+<;P};},<  = %= %28l PS,<=;%=;%,=$3=#%=#%,8=;m8l%PP,^=mz=I%=I%,==\%=\%,==]%=]%,==f%=f%1=f;fP+<>;/g#!R0./.0./././.,>=^%=^%1=^;^P,>=%=%+>8iV8lenS8dS,?Wd=%=%,(?z=_%=_%,N?=%=%,t?=%=%,n@%;}8set0}+?8uP,@=%=%1=;P,K@=%=%1=;P1=%=%,@=%=%1=;P,@=%=%,A=0%=0%,,A=O%;O%Q,RA=%=%,xA =%=%+ B88polQ;lD,)Q,A2P=%=%12P=;P1Yk=%=%,0BMZ=%=%+BP8pol};lD,)V;JbS;S;I};};!}; };!};j?0}1=%=%.*C.df/.0.df/././.,PC =%=%,vC=%=%,C\i=_%=_%+:D8pol`S;lDa,)V=Jbb,D=s%=s%1=s;sP1 =u%=u%,`D=%=%,D=#%=#%+0E=$,D=.%=.%,D2J=>%=>%, Ejw=T%=T%1=W%=W%+VE8acl#P;uR,|Ep!}!=Z%=Z%,E!!=d%=d%,E!!=%=%,E!!=%=%,F!!=%=%,:F!!=%=%+F;}+wF=%;P1p""=%=%+F(;}+FH=%;P1##=%=%,"G$$=%;P,HG`%s%=%=%,nGw%%=%=%+G`; V,G%&=%;P,Gq&&=%=%,G<'K'=%=%+Hx; vS+*H; qV,RH */*=n%;nP,xH ++= %= %,H +-+=%=%,H1+=+=%=%,I,,=%=%1,,=;P,4IS-`-= %= %,ZIh-u-=.%=.%,I--=8%=8%,J-.8pol:S;lD;,)Q,I--==%==%1--==;=P1.!.=?%=?%,P,tN<1<=%=%1<1<=;P+N0;/P0.O<`</.0.O<`</././.,N<=O== %= %,OW=j== %= %,.Or===# %=# %.bO.==/.0.==/././.+zOP8errJ P,O>>=6 %=6 %,O>>=I %=I %,O>>=Z %=Z %,P>>=k %=k %,8P>>=| %=| %,^P??= %= %,P!?4?= %= %,P??= %= %,P?@= %= %,P @@= %= %,Q%@8@= %= %,BQ@@S@= %= %,hQ[@n@= %= %.Q.@@/.0.@@/././.,Q,A?A= %= %+Qp8err P,RAA= %= %+R; ~; ~+_R8i Q0bUBkBAbV2Bc,RBB= %= %1BB= %= %,R0DCD=& %=& %,RwDD= %= %,S4EGE= %= %.NS.EF/.0.EF/././..S.F2F/.0.F2F/././..S.:FVF/.0.:FVF/././.+S?w 0.^FzF/.0.^FzF/././.+T 8errl P.FT.G,G/.0.G,G/././.+^T 8err[ P+T0 8lF PP2H ;a#I P1II?__vL >,T1J;J?__vK >,TKK=0 %=0 %+T` ;1 j#S,UoL|L=J %=J %+4U ;K j#S,ZU_MlM=d %=d %+rU ;e j#S,UON\N=~ %=~ %+U ; j#S,U?OLO= %= %+U ; j#S,V/P j#S,WjWwW=W %=W %+W ;X j#S,WXX=q %=q %+W ;r j#S,XYY= %= %,*X'[4[= %= %,PX8[D[= %= %+hX ; j#S,Xn\{\= %= %+X ; j#S,X]]= %= %+X ; j#S, Y^^= %= %+"Y8 ; j#S,HYB`O`= %= %,dYW`a; j#S,Yaa=< %=< %,Ya"c;= j#S,Y"c/c=[ %=[ %,Y:dGd=r %=r %,ZKdWd=s %=s %,>Z[dgd=t %=t %+ZP =4"u ;u V8errv S.Z.dd/.0.dd/././.2h = %= %,Zee= %= %+ [ 8kwl 9S=H ,2[ff= %= %+[ ;4" P; S8fd V8err };! ,~.[cgh/!cA-cP0.?iVi/.0.?iVi/././..\.jj/.0.jj/././.+C\ ;}1kk=%=%,i\ll=%=%,\mm=%=%,\mm=%=%,\mm=S%=S%.].TnWn/.0.TnWn/././.,5] oo=f%=f%,[] o0o=f%=f%+] ?hdrg(,]Soxo=o%=o%1Soxo;oR;oP0.o p/.0.o p/././.,^pp=%=%,9^pp=%=%+^ ?hdr(,^pp=%=%1pp;R;P0.tqwq/.0.tqwq/././.,^jr}r=%=%.%_@cCsUs/Sc0.CsUs/././.,K_ss=%=%,q_attt= %= %._.tt/.0.tt/././.,_uu=%=%,_guzu=%=%,`uu=%=%,a`/vMv=%=%1/vMv=;P,`Uvhv="%="%,`w x=%=%.`.xx/.0.xx/././..a.y y/.0.y y/././.,;ayz=%=%,aa zz=%=%,a}}=%=%+a ;0~,a~~=%=%,a~~=%=%,b~~=%=%,9b~8iV8cS,_b=%=%28 ;4+W2P 8iS8lenV8dVCb "Ddst"bDsrc"b b 2)(9c!>En=-ret?3:c!f4!e4 "e:c,3`c7i4h5e' p҇U6*;!eo8f fm; ! m;Z m; m+Yeh 8argS8invm8endW;>fm;-V,vd =r%=r%1 =r;rP,dPc=x%=x%,d=}%=}%,dɄ=~%;~%S,ë́܄=%=%,6e=%=%1=%=%+se ; 0m,eφ=%=%1҇;ZC7Q;>C7P,e=,D1=,E fh f @FhU;T p;Q#!l;!W;hI~,Lvi|i I,MviI.viIw iJ I2QiI  K'>#!K?L,LI3;0Mnow3<Ie 4X+Ih4]I4^  jj I 5wj ZjI5I5I 6Q0I6R0I 6U0I 6VI6Wj j ~LD!;j j kk  ,)]*k  k ?kk )yPk /k))! )7!,*0E%J!V0H"0Einti "0@;e&wk60>Sm?SRAS3C7DlEroS7 U7H 0o BT G QqFez DE#F#k 2L40 YpG {o  p #$[L ##  =R#J#=# M w ! # ۆ#n ܜ#" # E 9 -@5 - i?># / #  # b  # # # O# # z# #$ #( + #, M#0 0#4 .>#8 >>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ !<#`  # #B >#M  F  3   b #  9    #  #  # bit >#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H 0wq 1D#rq 2D# 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<]4w x@#ym#z0#  {0#L'|0#r}0#8~0#j?0# -0#$u#(  |)8J K0#* L0#{M#fdN># j?O0#expP0#4Q#c5R#4S# u5T#$ibU0 #(obU0 #,x V0#0W#40 # Uj?}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#,0#0 0#4H>#80) #< E#@E#Ae#DJ#L #P % #T+ #X_ 0tstru#lenv>#p p 0 v  p z m#L m# L# #fe #be # ># j? >#$Z 0#(req 0 #,rep 0 #0si #4 #$ # M#srv H#\ H#Q H#> #txn # ># # #2 ## …# Å#, m # 0#_   < ]e Tn  #!e # u k auid^&#gid_#`# buxau  LfdM># N>#TO>#>P#  Q #R>#%$S>#T0#U #Vm#)W #kAXR#&Y #LZ# [0#b #)c# TQum #n>#So>#p># q# r# s>#$4t #(5u #,v #0w #4gx #8,y #<hzm#@e{>#H|m#L   >> >  >  CfA #bB0 #.(?cbC#{D# EE#evFE# G#H#I>#  J#$   J8>#get>#put>#u># s#[) R##>#^# m#:X a^#_%#k`%#ale+,#-#.>#/e#  )< #;#55[)5#8len#90#cr#:0##;0#N #Cv#D#8#E##F#)#G#m3#H# A"    D "~"l">#m_l">#u">#u_l"># v">#v_l">#"l">#v_l">#c">#c_l"># r">#r_l">#"rq"'st"~D"P "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ژ#sl"#  "e#8 ">#@<"3"#N"# "6 #req"#rsp"#\uri"# "#"#I">#j?"0#sE &0#f 0#0# p H?IJH# K>#* L>#M># N># O#B P#'R#S># T>#$5 T>#(%$U0#,6U0#0tV>#44 V>#8'W>#<tXm#@}!YL#H>[M#L\\M#\?^M#l`>#|oa# b#@dH#dH#e#o fM#wg#h>#i>#;i>##j># j>#>j>#k>#l>#Fm>#ido#p0#b p0#q0#r0#us0#+t0#Vt0#guD# v#hwH#yw#yw#jz0# {1#}w#}w#~w#~w#w#.<# 0#w# w#w#Qw#U>#'lDR # #O# ># T>#r>#>#M#B"#,aclm#0m#8m#@m#Hs>5"#PsrvH#\e >#`? >#dh "#hY#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#v-]$##>#m#&##id#4+#tm#t>#4 >#>#0#w0#0#0# <#0#+<# 0#w#w# w#%$0#0#`0##z#### >#8#>#0#j0# 1#w#w# w# w# w# w# ) w# w# Qw# >#cap># \M# ? M#  ># o #  # m !# u !# J~# ~# ># ># >#  ># ># u># ># B># p # # ># Z># i$# ]i$# f# f# ]f# o$# o$# ># w #  ># !$# = "># #># $0# %0# F&!# :&!#HN; !! m#!!p #srv!"H# D  ># <# <# / <# 7# 7#  7#$k% ^#(} ^#,, ^#0 w#4Q w#< px Ə#sv H# ȅ#D ȅ# j? 0# iid >#I >#sid ># " ͘#m  iid >#px я#buf 0#sid 0# ptr >#bol >#  !(( ˃! !    p   p  QI!p7!>4un5< in6M!p2u7 #!x ,|}#t0~#t1~#9##># 0>#$ >#("<#len0#pos0# sid0#srvH#oe#src#buf+ #5"be!uZ"  0#<m#" srv"# ># >#H"Xact!#bck!#,"act#bck##>#Q ># >#># >#>#8 ># H#mapZ"# "#,V"#T ##W7##8##/#####H#W$ >#O3>#8>#:># ?># >#\>#}!>#v-W$! c$ $ $6 "$;">*U#sHQ"$U">0U#sHR$[$$J $$.v %$w> .%% $$Q%&now%<<3-#Q[0#"0Ei  "0@;e &ikint 60 >Em ?ER AE3 C D^Ero S UH  0oBTGQqFez %D%E#%F#9 *-p5 *- i?+~# /+ # + # b + # +# +# O+# +# z+# +#$ +#( + +#, M+R#0 0+X#4 .+~#8 >+~#< +#@ +">#D +#p#F H+$^#G b+(n#H +1#L +7#T d+8#X +:~#\ !+<t#`   +R ++R# +X#B +~#p n   3[ >   # #    R #J # #  wFy 6  7~# w 8~#2>40YFG Qo pg#!ڏ#\#n r#" # 7  b#  e  # # # bit~#u32"0*+#key,e#n#p#" - #ref!#h H0wq1p#rq2p# 3~#04~#450#86~#< 7#@8~#Dxxxh]4#w #x##y##z0#  #{0#L'#|0#r#}0#8#~0#j?#0# -#0#$u##( - |)8'J 'K0#* 'L0#{'M#fd'N~# j?'O0#exp'P0#4'Q #c5'R #4'S # u5'T #$ib'U\ #(ob'U\ #,x 'V0#0'W#4-\ # 'Uj?$}0#rex$~~#wex$~#rto$~# wto$~#cto$~#l$0#r$#w$# lr$#$>$0#($0#,$0#0 $0#4H$~#80)$E #< $7#@$7#A$W#DJ$#L $#P $Q #T$W #X 0$tstr$u#len$v~#  \  E p $z&#L&# &x# & #fe&#be&#&~# j?&~#$Z &0#(req&\ #,rep&\ #0si&'#4 &#$&#&#srv&O"#\&O"#Q &O"#> &'#txn&# &~#&%#&'#2&'## &w#&w#,&g'#&0#  K h ] Tn  #! # k auid ^&#gid _# `# bux a  Lfd M~# N~#T O~#> P#  Q # R~#%$ S~# T0# U # V#) W #kA X~#& Y #L Z# [0# b #) c# T Qu m# n~#S o~# p~# q# r#  s~#$4 t #(5 u #, v##0 w##4g x##8, y##<h z#@e {~#H |#L   ~~ ~  #~ JCfA #bB\ #.(?cbC#{D# E7#evF7# G#H#I~#  J.#$ ) . J8~#get~#put~#u~# C#E<_L`#c@a-#setb-#clrc-# Ad-#L@e-#remf?#clog?#4h\# 9ir#$Bj#($kr#,Glr#0um#4n~#8(~(~ ~?(3VV~4Er~VbVxp7>4un5h in6p2u7# .SC.O~#.P~#T.Q~# .R~# e .;uid.<~#gid.=~#.>~#%$.?~# ,.@~# .A~#!.B~#a.C~#.D~# h.E~#$ .F~#(<.G#,'.H#0.I#44+.I#8J.J~#<.J~#@.K~#D.K~#H.L~#L .L~#Pm .M#Tu .M#.S# .T #g.U~#5)8len)90#cr):0#);0#N )Cv)D#8)Ew#)Fw#))Gw#m3)Hw# e(           D ( (l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#;(rq(pst(D(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(#sl(#  (W#8 (~#@(3(e#N(# (b #req(;#rsp(;#\uri(# (#(#I(~#j?(0#) R##~#P# #: !a!^#!_%#k!`%#!ale + ,l# -r# .~# /# 'x < ##QI 'lD # r#O r# ~# T ~#r ~# ~# #B T##,acl #0 #8 #@ #Hs> r##Psrv O"#\e ~#`? ~#dh $#hY #Z # ~# # ~# 0# ~#g ~#[ # ~#R ~# # ~# ~# }#G #R ~#7 ~#v- ֚%# # ~# ٙ#& %#id #4+ #t #t ~#4 ~# ~# 0#w 0# 0# 0# # 0#+ # 0# i# i# i#%$ 0# 0#` 0# r#z r# r# r# # ~#8 # ~# 0#j 0# 1# i# i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# \ # ? #  ~# o #  # m # u # J p#  p#  ~#  ~#  ~#  ~# ~# u ~#  ~# B ~# p l#  l#  ~# Z ~#  %# ] %#  #  # ] #  %# %#  ~# w #  ~#  !%# = "~#  #~#  $0# %0# F &"# : &"#HCE &0#f 0#0# RF!;  #! #srv"O"# O"?"JO"# K~#* L~#M~# N~# O#B P#'R#S~# T~#$5 T~#(%$U0#,6U0#0tV~#44 V~#8'W~#<tX#@}!Yx#H>[#L\\#\?^#l`~#|oa# b.#@dO"#dO"#e#o f#wgw#h~#i~#;i~##j~# j~#>j~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gup# vU"#hwO"#yi#yi#jz0# {1#}i#}i#~i#~i#i#. # 0#i# i#i#Qi#U~#"x , | }#t0 ~#t1 ~#9 U"# U"# ~# 0 ~#$  ~#(T#  <#len 0#pos 0# sid 0#srv O"#oe #src #buf W #r# be u #   0#< ## srv ## ~# ~#O"#X act ["#bck ["#,$ act #bck # %  ~#Q ~# ~# ~#  ~# ~#8 ~# O"#map ##  ##,V ##T %#W7 %#8 %#/ %# %#%O" %%  ~#O3 ~#8 ~#: ~# ? ~# ~#\ ~#}! ~#v-%! % % %b }&D& &~#&<# &<# /&<#&#&#  &#$k%&P#(} &P#,,&P#0&i#4Q&i#<&&px&#sv&O"#&w#D&w# j?&0# iid&~#I&~#sid&~# ' &"&#g'&iid&~#px&#buf&0#sid&0# ptr&~#bol&~#'&((&}&&&& ' '- R' '' '"("2U#be1S$ ((%.(&(ӕ%.(':( 2('1)(#>~U#s=O"P*pc?'R+b"?'V+"?'W+"@~p, +C S&(FL-(S%('(hx.tgx.fg0)e)f#Z~U#sYO"V+"[~W, /a 0pb'$I)e)Ö-v)P&(ٖߖ-(S%(')";'.px;)) ")#u ՘U#stO"V*srvvO"S*msgwb h+"x~W, +#{~d"4*i"U#sO"V*srvO"S*msgb h+"~W"~*# lU#sO"S*srvO"S*msgb h+"~W1*#pU2sO"S3srv O"S3msg!b h4""~W5+#N~U2fdM~W68#ޝ6x#6"6"3tPxV3sQO"S$Y+(ޝ%(%(7+ 3ret^~P8<O9"e~8<C:__ve07+3sa8:__v>&+dl%,%,&',dl-8,P%C,'',#W~.nowV~(&V~'O,w"L~.nowK~(&K~5,"~(U2fd~68#3len~S3tx`3sO"\4#~d4#h&(Р֠%(%(;0"x0U2tx4/#~3s O"W3sa X3fd ~V3rv ~V6$I$|-0-0P-0R$-0ɢ%0%0$-1 U-1Q-1$-0%0-0P$-',-8,P%C,$.',n-8,S-C,P$4.0+G%0-0P$R.',GU-8,P%C,$p.0ͦ%0-0V7. 9#~$.',ͦߦ-8,S%C,$.',ߦ-8,P%C,&)1%:1%D1<.:__v;>7/84$BO13retC~4j?C~8<4*#R~3srcSH$/U1S%f18Y=q1P&1<-1Q-170X4$O1S3ret~P4j?~&(۩-.(P$0}1%1$=0',-8,P-C,P<0«9#~$t0',«ѫ-8,S%C,&)1ѫ%:1%D1$0(-.(P$00(<%0%0&',<K-8,P%C,'1{k~(j~.nowj~>)1L/(]..(a#.~'O1"u~.t1t~.t2t~'}1P#~(].0ret~>1"T.fdS~?{2C#?~U3pxAp3sBO"S:tCx4#D~l4#D~h4 $D~d$G2{2l@2,p@2722=2V&2%2$g2',-8,W-C,P&2/%2'2"x0txA0__p'2n6x.tx>2@( xB[*2eBJ *2B q4B.v3JBw~ 53C B,Q$3B-;0Dnow-<<B-=<Be .X B.^W Done.`(B.a3 E' >B Q0BR0B U0B VBW3p'&de0:$0Einti  "0@;e &wk 60 >Sm ?SR AS3 C7 DlEro S7 U7H  0oBTGQqFez DE#F#  n # p #e" - e# ref !#R]4w xR#ye#z0#  {0#L'|0#r}0#8~0#j?0# -0#$uX#( h n 2L40YsG ~o p#$[ L ##  @R#J#@# P w!#ۉ#n ܟ#" # E 9 %-C5 %- i?&># /& # & # b & # &# &# O&# &# z&# &#$ &#( + &#, M&#0 0&#4 .&>#8 >&>#< &#@ &"L#D &#~#F H&$#G b&(#H &1#L &7#T d&8#X &:>#\ !&<#`& &&# &#B &>#J  C  3 b#  6  # # # bit>#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj|)8"J "K0#* "L0#{"M# fd"N># j?"O0# exp"P0#4"Q#c5"R#4"S# u5"T#$ ib"U0 #( ob"U0 #,x "V0#0"W#40 # "Uj?}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#,0#0 0#4H>#80) #< E#@E#Ae#DJ#L #P % #T+ #X_ 0t stru# lenv>#p p 0 v  p z!e#L!e# !# ! # fe!# be!#!># j?!>#$Z !0#( req!0 #, rep!0 #0 si! #4 ! #$! #!P# srv!H#\!H#Q !H#> ! # txn!# !>#!#! #2! ## !…#!Å#,!m #!0#_   < ]e Tn  #!e # u k a uid^&# gid_#`# buxau  L fdM># N>#TO>#>P #  Q #R>#%$S>#T0#U #Ve#)W #kAX#&Y #LZ# [0#b #)c# TQum #n>#So>#p># q# r# s>#$4t #(5u #,v #0w #4gx #8,y #<hze#@e{>#H|e#L   >> >  >  C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$   J8># get># put>#u># s#[) R##>#^# e#: a^#_%#k`%#ale+,#-#.>#/h#  )< #;#55[)5$8len$90#cr$:0#$;0#N $C v$D#8$E#$F#)$G#m3$H# A#    D #~# l#># m_l#># u#># u_l#># v#># v_l#>## l#># v_l#># c#># c_l#># r#># r_l#>##rq#'st#~D#P #0# sol## eol## som#0# col#0# sov#0# eoh#0# cap#ژ# sl##  #e#8 #>#@<#3##N## #6 # req## rsp##\ uri## ####I#>#j?#0#sE &0#f 0#0# s H?IJH# K>#* L>#M># N># O#B P#'R#S># T>#$5 T>#(%$U0#,6U0#0tV>#44 V>#8'W>#<tXe#@}!Y#H>[P#L\\P#\?^P#l`>#|oa# b#@dH#dH#e#o fP#wg#h>#i>#;i>##j># j>#>j>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#+t0#Vt0#guA# v#hwH#yw#yw#jz0# {1#}w#}w#~w#~w#w#.<# 0#w# w#w#Qw#U>#'lDR # #O# ># T>#r>#>#P#B"#, acle#0e#8e#@e#Hs>5"#P srvH#\e >#`? >#dh "#hY#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#v-]$##>#e#&## id#4+#te#t>#4 >#>#0#w0#0#0# <#0#+<# 0#w#w# w#%$0#0#`0##z#### >#8#>#0#j0# 1#w#w# w# w# w# w# ) w# w# Qw# >#cap># \P# ? P#  ># o #  # m !# u !# J~# ~# ># ># >#  ># ># u># ># B># p # # ># Z># i$# ]i$# f# f# ]f# o$# o$# ># w #  ># !$# = "># #># $0# %0# F&!# :&!#HN;   e# !p # srv "H# D! !>#!<# !<# /!<#!7#!7#  !7#$k%!^#(} !^#,,!^#0!w#4Q!w#<! px!Ə# sv!H#!ȅ#D!ȅ# j?!0# iid!>#I!># sid!># !"!͐#m ! iid!># px!я# buf!0# sid!0# ptr!># bol!># !!((!˃!!!!   p   p  QI!p7!>4un5< in6P!p2 u7 #!x ,|}# t0~# t1~#9##># 0>#$ >#("<# len0# pos0# sid0# srvH# oe# src # buf+ #5"be!uZ"  0#<e#"  srv"# ># >#H"X act!# bck!#," act# bck##>#Q ># >#># >#>#8 ># H# mapZ"# "#,V"#T ##W7##8##/#####H#W$ >#O3>#8>#:># ?># >#\>#}!>#v-W$! c$ $ $6 "$$'0U#s&$S$max(0V%V&$60$ '}$>دU(1%]$]U#p Q%&j"%F$ap `GU#srv`HV#px`W$psb Q)ppb *cp S+%%ac,%+%%{,&-&հ.(&p.3&l/%k$1 0s1$/ &"; 0px; && N/?&>0tv1?&0tv2?&E& <(&$CPU#sBHV$pDp*%$E>W%p*Mp P-&.&S,&/&h0tg0fg0" '-$ U1p S)p 2$__pQ3[%-'3J %-'3.vM'3w> q'4 3'Q`'5now<<65 f 3 Q03R03 U03 Vf3W'A6z)j0%#0Ei "0@;e&ikint60>Em?ERAE3CD^EroS UH 0oBTGQqFez %D%E#%F#9 +-p5 +- i?,~# /, # , # b , # ,# ,# O,# ,# z,# ,#$ ,#( + ,#, M,j#0 0,p#4 .,~#8 >,~#< ,#@ ,">#D ,#p#F H,$v#G b,(#H ,1#L ,7#T d,8#X ,:~#\ !,<#`    ,  ,j ,,j# ,p#B ,~#3p,3$[> ## "R#J#"#2w^y6 7~# w8~#2>40Y^G io p#!ڧ#t#n ܊#" #7 b#--}  # -# -# bit~#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D 5]4$w $x#$y#$z0#  ${0#L'$|0#r$}0#8$~0#j?$0# -$0#$u$5#(E |)8&J &K0#* &L0#{&M#fd&N~# j?&O0#exp&P0#4&Q%#c5&R%#4&S%# u5&T%#$ib&Ut #(ob&Ut #,x &V0#0&W#4  Et # &Uj? }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H ~#80) ] #< 7#@ 7#A W#DJ #L #P  i #T o #X+ 0 tstr u#len v~#  t  ] p  z #L # # #fe )"#be )"# ~# j? ~#$Z 0#(req t #,rep t #0si 1$#4 #$ # #srv #\ #Q #> A$#txn o# ~# l"# S$#2 j$## w# w#, $# 0#  c  ] Tn  # ! # k auid^&#gid_#`# buxa  LfdM~# N~#TO~#>P#  Q #R~#%$S~#T0#U #V#)W#kAX#&Y#LZ# [0#b #)c# TQum#n~#So~#p~# q# r# s~#$4t#(5u#,v;#0w;#4gx;#8,y;#<hz#@e{~#H|#L  ~ ~ ~+;~ +bCfA#bBt #.(?cbC#{D# E7#evF7# G#H#I~#  JF#$AF J8~#get~#put~#u~#  #+E<_L`#c@aE#setbE#clrcE# AdE#L@eE#remfW#clogW#4ht# 9i#$Bj#($k#,Gl#0um#4n~#8@~ @ ~ ~+ W @K n n ~L]~ nz  np7>4un5 in6p2u7#$-SC-O~#-P~#T-Q~# -R~# e -;uid-<~#gid-=~#->~#%$-?~# ,-@~# -A~#!-B~#a-C~#-D~# h-E~#$ -F~#(<-G#,'-H#0-I#44+-I#8J-J~#<-J~#@-K~#D-K~#H-L~#L -L~#Pm -M#Tu -M#-S# -T #g-U~#) R##~#P# #:9 "a"^#"_%#k"`%#"ae!+!,#!-#!.~#!/# D 9< ##  E &0#f 0#0#Q5)8len)90#cr):0#);0#N )Cv)D#8)Ew#)Fw#))Gw#m3)Hw# (           D (O(l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(st(OiD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(i#sl(#  (W#8 (~#@ (3(#N(Q# (z #req(#rsp(#\uri(# (#(#I(~#j?(0#^!?IJ# K~#* L~#M~# N~# O#B P#'R)"#S~# T~#$5 T~#(%$U0#,6U0#0tV~#44 V~#8'W~#<tX#@}!Y#H>[#L\\#\?^#l`~#|oa# bF#@d#d#e#o f#wgw#h~#i~#;i~##j~# j~#>j~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# v/"#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#)"'lDR # #O# ~# T~#r~#~##Bi%#,acl#0#8#@#Hs>%#Psrv#\e ~#`? ~#dh /&#hY#Z #~##~#0#~#g~#[# ~#R ~##~#~#Қ#G #R~#7~#v-֯'##~#ٱ#&0'#id#4+#t#t~#4 ~#~#0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0##z#### ~#8#~#0#j0# 1#i#i# i# i# i# i# ) i# i# Qi# ~#cap~# \# ? #  ~# o #  )"# m # u # Jp# p# ~# ~# ~#  ~# ~# u~# ~# B~# p # # ~# Z~# '# ]'# # # ]# '# '# ~# w #  ~# !'# = "~# #~# $0# %0# F&$# :&$#Hl"; '' #'! #srv'"# #D  ~# <# <# / <# # #  #$k% P#(} P#,, P#0 i#4Q i#<# px )"#sv # w#D w# j? 0# iid ~#I ~#sid ~## " #$ iid ~#px )"#buf 0#sid 0# ptr ~#bol ~#1$ (( # Δ# ֫#A$E5" S$ G$ j$ Y$$x ,|}#t0~#t1~#9/"#/"#~# 0~#$ ~#(i%<#len0#pos0# sid0#srv#oe)"#src#bufo #%be)"u%  0#<#% srv%# ~# ~# &Xactp$#bckp$#,/&act#bck#'~#Q ~# ~#~# ~#~#8 ~# #map%# %#,V &#T *'#W7*'#8*'#/*'#*'# *' '' ~#O3~#8~#:~# ?~# ~#\~#}!~#v-'! '' 'z ?(%*dow*~#h1*~#m1*~#h2*~ #m2*~#(*min*i#max*i#0%*~#%*~#(*>*ϊ#L*Њ#(*i*~]*?($*ц(%*')*ptr*str*reg*)9o)%,**Ʊ#val*ӫ(#ptr*(#8%*# len*~#$j?*~#() *p*i*~ll*id*)a*)QI)*$0*i*~#ptr*#len*~#j?*~# ctx*o)#u*$%*kw*# **# c%*(+# ?B*C+# *0# &* ~#*~  * )u**~ )"  ~ * "+*"+A* *!#kw*"+#arg*%+# %*&~# %*'#)*C+~ "+ *.+t+%* *#kw*t+#+*!"+*%#str*$*$+$/U%s. S&Z0p'+(,) ,V),W*",n&.~+fd.~+sa.",,%.(,-21)@~U%fd@~.lA }.pB)"W/sC .txnD21}/tE.cfdF~}&9&G~}0i%{0$\0 &-0S%-0& 0$0a&0T&1$/&>P~&$Q}1K-.__pnV2-81@3I143I11~-(5S1}'`19?(q12-{1(12-1(12-1GS)1R(11.@6pnI1~6snI1}1N.`6len[~P76pnk1}78__vr>1f.x6__pxR2}.1(12.2(21.6__pR2.1(12.!2JP(.22.92RX(J2(S2']2(j2'1)1S(19W/м6pna~7м8__vh>1o/6__pQ9/m}8__s1/6__p!Q9/ɾ8__s$1/6__p*Q2/u20)2P7 3290Q6msgz }9706msgz }9R0.maxJ~P9l07B8__vT>108__vS>10(6pn9~6sn9~90GR8__vD>4@8__vC>202-\(291\i:j212Sv(2'2%(2o*`1"/t;/__p*{1n6+t<1%E+feD)"*1x1+tvx1<<1C%1+ctr01+inc001-<2s%/+buf.t px)">l4 R>l7>dir~?B*?$"+Q=3D&~CU>px)">l4 P>l7>dir~?B*?$"+R938__v >7#.8__v >=R4$~PU>px)">l4 S>l7>dir~?B*?$"+V=4$(~KU>px&)">l4& S>l7&>dir&~?B'*?$'"+V948__v/>7&18__v->=d5)&9~PkU>px7)">l47 P>l77>dir7~?B8*?$8"+P@%OpUA[+5eAJ +5A qLA.v5bAw~A x~A -\~5BA.Q5A;0Cnow<<A=<Ae -X$A-^o Cone-`@A-aW6 2A $Aj /A, /A Q0AR0A U0A VAW6D%@I+8$3,s0'0Ei  "0@;e &ikint 60 >Em ?ER AE3 C D^Ero S UH  0oBTGQqFez  D E# F# [ > p##  Rp#J##  w 2>40YG Mo p'#!p##n 2#" # 7 9 !-@5 !- i?"~# /" # " # b " # "# "# O"# "# z"# "#$ "#( + "#, M"#0 0"#4 ."~#8 >"~#< "#@ "">#D "#p#F H"$#G b"(#H "1#L "7#T d"8#X ":~#\ !"<#` " ""# "#B "~#M  F  3 b#  9  # # # bit~#u32"0m*+#key,9# n #p #m" - m#ref !#< H 0wq 1D#rq 2D# 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<]4w x@#ym#z0#  {0#L'|0#r}0#8~0#j?0# -0#$u#(  |)8#J #K0#* #L0#{#M#fd#N~# j?#O0#exp#P0#4#Q#c5#R#4#S# u5#T#$ib#U0 #(ob#U0 #,x #V0#0#W#40 # #Uj?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#80) #< 7#@7#AW#DJ#L #P % #T+ #X_ 0tstru#lenv~#p p 0 v  p z$m#L$m# $L# $ #fe$#be$#$~# j?$~#$Z $0#(req$0 #,rep$0 #0si$!#4 $#$$#$M#srv$#\$#Q $#> $!#txn$# $~#$( #$"#2$&"## $w#$w#,$!#$0#_   < ]e Tn  p#!e # u k auid^&#gid_#`# buxau  LfdM~# N~#TO~#>P#  Q #R~#%$S~#T0#U #Vm#)W #kAXR#&Y #LZ# [0#b #)c# TQum #n~#So~#p~# qp# re# s~#$4t #(5u #,v #0w #4gx #8,y #<hzm#@e{~#H|m#L   ~~ ~  ~  CfA #bB0 #.(?cbC#{D# E7#evF7# G#He#I~#  J#$  { J8~#get~#put~#u~# #E<_L`#c@a#setb#clrc# Ad#L@e#remf#clog#4h0# 9iF#$BjX#($kF#,GlF#0um#4n~#8~~ ~**~F~*6X*L) R##~#P# m#:^X a^#_%#k`%#aEe+,E#-K#.~#/# Q < ##5'8len'90#cr':0#';0#'N 'Cv'D'#8'Ew#'Fw#)'Gw#m3'Hw# r&    D &-&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#+&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#H&rq&}st&D&P &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&+#  &W#8 &~#@&3&r#N&# &6 #req&H#rsp&H#\uri&# &#&#I&~#j?&0#E &0#f 0#0#  ?IJ# K~#* L~#M~# N~# O#B P#'R#S~# T~#$5 T~#(%$U0#,6U0#0tV~#44 V~#8'W~#<tXm#@}!YL#H>[M#L\\M#\?^M#l`~#|oa# b#@d#d#e#o fM#wgw#h~#i~#;i~##j~# j~#>j~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#+t0#Vt0#guD# v#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#'lDR # 2#O2# ~# T~#r~#~#M#Bm##,aclm#0m#8m#@m#Hs>##Psrv#\e ~#`? ~#dh 3$#hY#Z #~##~#0#~#g~#[# ~#R ~##~#~#V#G #R~#7~#v-ֳ%##~#m#&4%#id#4+#tm#t~#4 ~#~#0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0#2#z2#2#2## ~#8#~#0#j0# 1#i#i# i# i# i# i# ) i# i# Qi# ~#cap~# \M# ? M#  ~# o #  # m ["# u ["# Jp# p# ~# ~# ~#  ~# ~# u~# ~# B~# p E# E# ~# Z~# %# ]%# # # ]# %# %# ~# w #  ~# !%# = "~# #~# $0# %0# F&"# :&"#H( ; %% m#%!p #srv%"#  D$ $~#$<# $<# /$<#$#$#  $#$k%$P#(} $P#,,$P#0$i#4Q$i#<P!$px$#sv$Ǟ#$w#D$w# j?$0# iid$~#I$~#sid$~#g! $"$͘#!$iid$~#px$#buf$0#sid$0# ptr$~#bol$~#!$!(($ !$P!!$g! ! "p "&"p "QI["p7!>4{un5< in6Mt"p2u73"#"x ,|}#t0~#t1~#9##~# 0~#$ ~#(m#<#len0#pos0# sid0#srv#oe#src#buf+ ##be!u#  0#<m## srv## ~# ~#$Xactt"#bckt"#,3$act#bck#"%~#Q ~# ~#~# ~#~#8 ~# #map## ##,V$#T .%#W7.%#8.%#/.%#.%#.%"%% ~#O3~#8~#:~# ?~# ~#\~#}!~#v-%! % % %6 & +$+%~#kw+&# +-D&#D&~~~&r& +5+6m#kw+7r&# &% &(SC(O~#(P~#T(Q~# (R~# @(e (;uid(<~#gid(=~#(>~#%$(?~# ,(@~# (A~#!(B~#a(C~#(D~# h(E~#$ (F~#(<(G#,'(H#0(I#44+(I#8J(J~#<(J~#@(K~#D(K~#H(L~#L (L~#Pm (M["#Tu (M["#(S&# (T #g(U~#"i(&2U#cap1~R"(R'BU$B~R%+&Y~U$>W$W~ $'W$l'X#errX$X~&&Z0p&[~l'cap[~W'res\P&u\S'tv] h'td^ V(|)X)c%)c%*)=J)g%)g%*)NZ)g%)g%+)+,-+*)4A)l%)l%*#*ER)p%)p%*G*)t%)t%*k*)t%)t%**)y%)y%**)y%)y%**Xe)~%)~%**)%)%-)%)%.9+ 2/'1%v,;'~YU$>S$~ $'$l'#err$~&~l0cap~'resp)u'tvv,W0tdv,'val0V(,x)%)%*?,4D)%)%+b,|,aq,,1,P,,2+,-+03,*'3P414x142~"b-'`=U$u$~ #cap~W&QS&/p*7-)%)%+N-+,-+2+,-+5-a'@U6px-W7u 8'S8/V-`u9%9%- 5~.&3~U7Q2S+%.+,-++<.+2>,-++S.+`l,-++j.+,-+2+,-+5./&X~U7&W~8QYV8 Z S8&[~W:err[~~8'\~~:msg]./~+/+#,-+2+o{,-+ >/ c;/ KU:pS2/$1/P1/P./w"L~t~+00h11Q,12&1t,71,B1+0N11_1Q,i12N11_1Q,i12/1/S,/.&1&~__vj>->__vh>?'U@[!@2@J !@2@ q@.vm2@w~@ (\~ 2A @)Q2B'(B)~Ж@*;0Cnow*<<@e (X&Bh'~ @(b~8r'zJ&ԖX8q0|0* 0Ei  "0@;e &ik 5int 60 >Em ?ER AE3 C D^Ero S UH  0oBTGQqFpz "D"E#"F#9 (-{5 (- i?)# /) # ) # b ) # )# )# O)# )# z)# )#$ )#( + )#, M)]#0 0)c#4 .)#8 >)#< )#@ )">#D )#p#F H)$i#G b)(y#H )1#L )7#T d)8#X ):#\ !)<#`  )] ))]# )c#B )#&{ y   3 $[ >   # #   R #J # # % wNTn  #!N# ^ k2>40Y^G io p#!ښ#t#n ܊#" # 7  b# -- }  # -# -# bit#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D5]4!w !x#!y#!z0#  !{0#L'!|0#r!}0#8!~0#j?!0# -!0#$u!5#( E |)8#J #K0#* #L0#{#M#fd#N# j?#O0#exp#P0#4#Q%#c5#R%#4#S%# u5#T%#$ib#Ut #(ob#Ut #,x #V0#0#W#4Et # #Uj?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#80)] #< 7#@7#AW#DJ#L #P i #To #X+ 0tstru#lenv#  t  ] p z#L# #  #fe!#be!## j?#$Z 0#(reqt #,rept #0si##4 #$##srv#\#Q #> $#txn6# #3"#$#21$## w#w#,##0#  c ] auid^1#gid_#`&# buxa  LfdM# N#TO#>P#  Q #R#%$S#T0#U #V#)W #kAX#&Y #LZ# [0#b #)c# TQum #n#So#p# q# r# s#$4t #(5u #,v#0w#4gx#8,y#<hz#@e{#H|#L       )CfA #bBt #.(?cbC#{D# E7#evF7# G#H#I#  J #$    J8#get#put#u# #E<_L`#c@a #setb #clrc # Ad #L@e #remf#clog#4h;# 9iQ#$Bjc#($kQ#,GlQ#0um#4n#8 55$Q5Ac5Wp7>4un5%in6p2u7i#*SC*O#*P#T*Q# *R# ie *;uid*<#gid*=#*>#%$*?# ,*@# *A#!*B#a*C#*D# h*E#$ *F#(<*G#,'*H#0*I#44+*I#8J*J#<*J#@*K#D*K#H*L#L *L#Pm *M#Tu *M#*S# *T #g*U#) R###P# #:i a^#_%#k`%#aPe+,P#-V#.#/#  \ < ##E &0#f 0#0#5&8len&90#cr&:0#&;0#iN &Cv&Di#8&Ew#&Fw#)&Gw#m3&Hw# %           D %o%l%݉#m_l%މ#u%߉#u_l%߉# v%#v_l%#m%l%#v_l%#c%#c_l%# r%#r_l%#%rq%st%0D%P %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%0#sl%m#  %W#8 %#@%3%#N%# %z #req%#rsp%#\uri%# %#%#I%#j?%0# ^!?IJ# K#* L#M# N# O#B P#'R!#S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tX#@}!Y#H>[#L\\#\?^#l`#|oa# b #@d#d#e#o f#wgw#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# v!#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#!'lDR # #O# # T#r###B0%#,acl#0#8#@#Hs>N%#Psrv#\e #`? #dh %#hY#Z #Ɖ##ȉ#0#ʉ#gˉ#[# ͉#R Ή##Љ#щ#a#G #Rԉ#7Չ#v-v'##؉#ٱ#&&#id#4+#t#t#4 ##0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0##z#### #8##0#j0# <#i#i# i# i# i# i# ) i# i# Qi# #cap# \# ? #  # o #  !# m # u # Jp# p# # # #  # # u# # B# p P# P# # Z# '# ]'# # # ]# '# '# # w #  # !'# = "# ## $0# %0# F&$# :&$#H3"; $$ #$! #srv$"# "D #G# G# /G###  #$k%P#(} P#,,P#0i#4Qi#<[#px!#svǩ#w#Dw# j?0# iidʉ#Iʉ#sidʉ#r# "##iidЉ#px!#buf0#sid0# ptrԉ#bolՉ##(("[#r# $E !$ $1$  $$x ,|}#t0~#t1~#9!#!## 0#$ #(0%G#len0#pos0# sid0#srv#oe!#src#bufo #N%be!us%  0#<#% srv%# # #%Xact7$#bck7$#,%act#bck#&#Q # ## ##8 # #maps%# %#,V%#T &#W7&#8&#/&#&#&&p' ۉ#O3܉#8݉#:މ# ?߉# #\#}!#v-p'! |' ' 'z QI"'(5QU# 4 Q$((L`U# K R% M S&errN'((()*(+(),)V,"),-),8))-C)_-N)-Y)-d)P-o)W.z)&.).).)_')()/))0  1fd2)(k31j4uidj14gidj3j&5(l)5)m)5>n%6retp5 p7(7)7)7R( )8)"T4fdS$?*(^U# ] P% _ S'?*(Q*'^*,k*~)-v*~-*V-*P/^**$0 # 8*>(315>%5 ݉6ret݉9,)sU:fds&lt ~1su 1tv&cfdw~%9&x~;i%9F;$6'; &4;n(2~%$~-4tǐ9/H)CDU:sB #-BQ%>D/&argEW@-:P>^%>^%@-Vb>_%>_%+./(/,/P(/+%./(/,/P(/@K.>l%>l%@q.>r%>r%@.>v%>v%+./(/'/(/(0( 0+./(/'/(/(0( 0+3//(/'/(/(0( 0+V//(/,/P(/'/'3(/'/'3(/(0( 0 / 8/!)4s 4bt 3)] A/7i0hA0 -0+0x+00,90(PU:s S:reqt V%-W1p+00,0R,1Q+01 ,1P@0(6&__sW+0)169(61'1Q`(121{k3j4nowj8)1](4buft 8B1(4buft 9=5 )U:t&s p%)l%)0h%)0W;u)u;9)x;'<1 >j?0'=5#(J5@ 2'P%j?0R'=516(J5+72V5gr(c5+2o5p(5(5+r2o5p,5R,5V'o5,5R,5V+2o5(5,5S+2o5 (5(5+251T(5,5V)@-5R+ 3V5T\(c5+635s(5,5V)`-5R@P3<>j?0+g35T^(5+~31v(1+31(1+35(5+3558(5'558( 6+46B]($6'.6BK(;6+?4M6](^6'h6g(y6'.6gu,;6P+V4'-(4-+m46PS(6+40`w,0P,1Q+40|,0P,1Q+40,0P,1Q'6&(6+40,0P,1V+50,0P,1V'0,0P,1V8V5%4buft 8o5)u4buftt 25"u4t1t4t2t85'c4bufbt 38@b05'd085'4buft 25"4t26 ~4t}2.6 v4tu8G6]3\G62h64t264t86(M4bLt B`)UC.'K66 >C~'L66 ~C'M6C[(6pCJ (6C qC.v$7)CwC xC *\ b7D C+QQ7C,;0Enow,Em?ERAE3CD^EroS UH 0oBTGQqF{z )D)E#)F#G37 3J3G# { @3J9 /-V5 /- i?0# /0 # 0 # b 0 # 0# 0# O0# 0# z0# 0#$ 0#( + 0#, M0#0 00#4 .0#8 >0#< 0#@ 0">#D 0#p#F H0$#G b0(#H 01#L 07$#T d08$#X 0:#\ !0<#`7b \$y$0 00# 0#B 0#    3tm,w1x#"y#tz#|{# @|#T}#8~#l## #$\#($[> ##  !R#J#!# 1 wVnV#pV#1" - 1#ref!V#]4(w (xm#(y1#(z0#  ({0#L'(|0#r(}0#8(~0#j?(0# -(0#$u(#( . Q bQ# aa .  6# a# a# bit#u32"0*+g#key,#` H0wq1#rq2# 3#04#450#86v#< 7$#@8#Dppp`)  R # # # P#  1#: | R # #2>40Y G Po p*#!ڦ##n 5#" # 7 s |)8 J K0#* L0#{ M$#fd N# j? O0#exp P0#4 Q #c5 R #4 S # u5 T #$ib U #(ob U #,x V0#0 W$#4  s  #  Uj? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #80) #< 7#@ 7#A W#DJ  #L  #P  #T #X  0 tstr u#len v#     p  z 1#L 1# p# Y#fe ##be ## # j? #$Z 0#(req #,rep #0si %#4 #$ # P#srv #\ #Q #> %#txn # # $# &#2 &## ‚# Â#, ׷%# 0#   ] Tn# # ##! #  k L auid^<#gid_&#`1#_ buxa f LfdM# N#TO#>P#  QS#R#%$S#T0#UY#V1#)Wo#kAXv#&Yu#LZ$# [0#bL #)c#S TQum{#n#So#p# q# r# s#$4to#(5uo#,v#0w#4gx#8,y#<hz1#@e{#H|1#Lf_ o_  S CfAo#bB #=.(?cbC=#{D$# E7#evF7# GM#H#I#  J#$ M  J8#get#put#u# #S  !!#!#!#% !!%#!#G!#v-(!'#!(#&!)#!*#!+# 4+!+#5!,#j?!-#-!.#!/%# !0#$++! ''+#u'#Z'#len' # H'!#\E'"#Yp"7>"4un"5 in"6Prp"2u"71# 1SC1O#1P#T1Q# 1R# 1e 1;uid1<#gid1=#1>#%$1?# ,1@# 1A#!1B#a1C#1D# h1E#$ 1F#(<1G#,'1H#01I#44+1I#8J1J#<1J#@1K#D1K#H1L#L 1L#Pm 1MY#Tu 1MY#1Sr# 1T_ #g1U# d %a%^$#%_%#k%`%#%a1z%e %j%ho#_%io#C%jze$+$,#$-#$.#$/\#  d)< V#;#55)xE &0#f 0#0#5,8len,90#cr,:0#,;0#N ,Cv,D#8,E#,F#),G#m3,H# x S+!!!! ! !!!! ! D + +l+ݔ#m_l+ޔ#u+ߔ#u_l+ߔ# v+#v_l+# +l+#v_l+#c+#c_l+# r+#r_l+#)+rq+^st+D+P +0#sol+#eol+#som+0# col+0#sov+0#eoh+0#cap+#sl+ #  +W#8 +#@s+3+S#N+# + #req+)#rsp+)#\uri+# +#+#I+#j?+0#D.+ -+\#idx+#val+# #+#  "?IJ# K#* L#M# N# O#B P#'R##S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tX1#@}!Yp#H>[P#L\\P#\?^P#l`#|oa# b#@d#d#e#o fP#wg#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# v##hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.A# 0#i# i#i#Qi#U##'lDRY# 5#O5# # T#r##P#B'#,acl1#01#81#@1#Hs>7'#Psrv#\e #`? #dh '#hY#Z #Ɣ##Ȕ#0#ʔ#g˔#[# ͔#R Δ##Д#є##G #RԔ#7Ք#v-##ؔ#1#&(#id#4+#t1#t#4 ##0#w0#0#0# A#0#+A# 0#i#i# i#%$0#0#`0#5#z5#5#5## #8##0#j0# G#i#i# i# i# i# i# ) i# i# Qi# #cap# \P# ? P#  # o #  ## m Y# u Y# Jp# p# # # #  # # u# # B# p # # # Z# +# ]+# # # ]# Y)# Y)# # w #  # !i)# = "# ## $0# %0# F&&# :&&#H6$; ** 1#*! #srv*"# $D  # R# R# / R# # #  #$k% P#(} P#,, P#0 i#4Q i#< D% px ##sv ǒ# Ȃ#D Ȃ# j? 0# iid ʔ#I ʔ#sid ʔ# [% " \# % iid Д#px ##buf 0#sid 0# ptr Ԕ#bol Ք#% (( $ D% [% % #& %&   &&x ,|}6#t0~6#t1~6#9##### 0#$ #('R#len0#pos0# sid0#srv#oe##src#buf #7'be#u \'  0#<1# ' srv'# # # 'Xact &#bck &#, 'act6#bck6# (#Q # ## ##8 # #map\'# '#,V'#T (#W7(#8(#/(#(#(( Y) ۔#O3ܔ#8ݔ#:ޔ# ?ߔ# #\#}!# i) y) #)/$-#$u.)@) *1# lD+.*#be/y)# .*C+ -?1# g-@1#pol-A# -B0# --C#)*x(2 31# lD4.*# I5# 6# %7# 8# j?90# :# ;#$'+%-dow-#h1-#m1-#h2- #m2-# n+-min-i#max-i#0%-˔#%-̔# +->-5#L-5#+-i-Ȕ]-'+$-n+%-*+-ptr-$str-reg-+dW,%,--1#val-ӓ+#ptr-+#8%-s# len-ڔ#$j?-۔#(, -p-$i-ll-id-,a-,QI ,$ ,$0-i-#ptr-#len-#j?-# ctx-W,#]-$%-kw-\# -}-# c%-.# ?B-+.# -0# &- #w-gw-u+]--# $- .- .A- -!1#kw-".#arg-%k.# %-&# %-'1#,-+. .w-.\.%- -1#kw-\.# k.,"#.-%%str-$,.(+3S#len# .# .b  .&=/09U'iǔQ'tmpQ'msgɔS('/6K)__s$*K_)__s$+/]3r@U,bp ,msgp/W-Nq/p- q\S.8@sP/lens)+(0E,#U,b R,msg/S-N/V- \,lenW.8@P+020U,hdr\,end\V-u\,lenW0val\R+0b.\U,s\P,e\S.,V.--Q+1/ U-u\,len ,sol\W,idx/R,ctx10eol\V0sov\S.B0p13 1-s211314131s51J0<6;/511160/+I2/ U-u\S,sol\ ,idx/,ctx 172E*U,t S,si R,err-.* -IW,msg2V22383Q223'^3343^c3(32 931:buf~ 943%:buf +k3~4)k3U,s( S-V3(Q ;3_27SqU,str6\p,len6l0m87P0h93S3 .;4A+PCU,txnO4P0ptrQQ0endQS<41PU,s~ W,si~  0txn4V0rdr h.1Q0lenS44~3424484Q344 53594.(:s'95C%1:ctr05:inc00A9$5%":ctr!5~0hdrS2678!7~8-7P26D7Kc3U73`726w73737*>7(6/__vE>*7G/__vD> 7?97"@now!97@tm!>7 G5l7*:tv1l7:tv2l7r7 RA7JP@tv1Il7@tv2Il7/retKP<8=2ep#U,somc,idxc/ ,capd-! d+0eolfp0solfl0colfV0sovfW.B0gh0hh+S0lenid2}81qs3128131B0__p~$Q+9-\0U,msg/V-/\W- 0S,ptr\R,end\Q--/-{+9 1,1{*E121r31p01.01,z1*a0+:.(\U,msg%/S-/%\ - &0P,ptr&\R,end&\Q--/'W-{+'9 1--1{*15/C1[,L}184YC1.dO1'1m1;1N11n2[h14-f<9<*F6E/:lenE:crE9<%"6!/C)e$x< =Q-t e U,esq =S,sq p,bufr W,msgr/V-s/s#l&+]>j-p U,t -#P0txn4d.v-`."\=/.B0V0hSD=0__s$W2=1  31D=/len72=]>  3j>2>v>  8>Q2&>>  3>2G>>? \ 3>3>3>B0msgQ h9v>(:buf 9>':buf 9>](:buf 9>!):s :b 6) +]?B3m U,sl  S,reql V0txnn 4W27?]?8n?P8y?R4w73737BE7P5?{k6j:nowj+@1 %U,s  ,req  0msg /W.@, PT.L' i@0ctx sX1. ,(]@).0 0PB/c B@0hex 0R*z., P2{@]?3n?8y?P2@]>3j>4@8@R8@P4@8AP3 A5@#W:nowV6&V5Aw"L:nowK6&K4VB0retAP443>4>443>2N<J7a78<P*[7a7><2NTPa7g73aP8lPRDN@EwPPDN`0lenZ S(?O`9:0eol V0sol h2+O199314199312VOv>::3>2mO>::3>2Ov>;;3>2O>;;3>2Ov>A<D<3>2O>D<G<3>2O><=3>2Ov>==3>2P]>>>3j>2*PP>>3P3P4w7>>3737*>>E7P9P'c:bufb 68@b0F'd09P,:buf 68+V0?YU,s ,req  .B0W0txn40msg/.4#~1v1R .I1,` AA1',4 +HDQx.lD.*W.JVS=0#DQ0retPB0retRB(0rdr .+\R2QVA B3V44AA84R34DRX./IV.-IW./I~.B0J~.s*J~.JP0valJP.H/K~41SBVB31DRx.JVWDR0retR4VEE3V44EE84R342SVzFF3V44FF84R3423SP+HGH3P3P2LS3qHH83R2cS]>HH3j>2S@HH8@Q8@P2S@HH8AP3 A2S@HH8AP3 A2SVJJ3V44JJ84R34DAT0lenPWB. i0ctx s4]>LL3j>D|T.1\~.,VB0qsPDT00lenS0pnVVDTH0lentS0pnuVW(U"QQ0eolS0solV2U1EQPQ3141fQmQ31DFU`.lD.*VBx0retPD^U0__p$Q(zURR.*2SDU.P.-S4Z<VSS3g<8r<P8}<R2U 5SS35DU0lenS0pnW2V]?\TwT3n?8y?P24V 5V+V352KV]>KVNV3j>2V@aVV8@R8@P4@yVV8AP3 A2V 5VV352V]>^WaW3j>DV0ctxs4 5XX354*9V& N:be M#) W -;vW 3YlYU- gS-Dw-W-0u/len.3P;X3pYYU,px#,l4  ,l7$R,dir-B--$ .Q.3P/txn4;EX1Y/ZU-$ .Q-Dw-S=$2;X-0ZqZU- gS-Dw-V-0u;%Y}/ZZU,px#,l4  ,l7$P,dir-B--$ .V/txn40ptrR0lenQ;Y,Z9[U,px#,l4  ,l7$P,dir-B--$ .V/txn 40ptr R0len Q;Z+%@[[U,px##,l4#  ,l7#$R,dir#-B$--$$ .V/txn&4/ptr'0len(P4Zq[[8ZQ8ZS*v[[EZR5Z30:s\:len)i0;.[-<[[U,px:#,l4:  ,l7:$R,dir:-B;--$; .Q/txn=4;[0T[c\U,pxR#P,l4R V,l7R$R,dirR-BS--$S .S/txnU4;:\3tp\\U,pxr#P,l4r S,l7r$R,dirr-Bs--$s .V/txnu4*\\/__v>;\M4\]U,px#P,l4 R,l7$P,sol -B-W-$ .S/txn40idx/Q0ctx1V;J]+]]U,px#V,l4 S,l7$Q,dir-B-R-$ .P/txn4;]O+]/^U,px#V,l4 S,l7$Q,dir-B-R-$ .P/txn4;j^d10^^U,px#P,l4 R,l7$P,sol -B-W-$ ./txn40idx/V0ctxsX0cntS;^.^^U,px#V,l4 S,l7$Q,dir-B-R-$ .P/txn4;^_0^_U,px#V,l4 S,l7$Q,dir-B-R-$ .P/txn4;_ - __U,px #P,l4  R,l7 $P,sol  -B-W-$ .V/txn40idx/Q0ctx1S;n`3*_`U,px(#V,l4( S,l7($Q,dir(-B)-R-$) .P/txn+4;`,= `_`U,px;#V,l4; S,l7;$Q,dir;-B<-R-$< .P/txn>4;a/O``,aU,pxM#P,l4M p,l7M$P,solM -BN-S-$N .V/txnP40idxQ/Q0ctxR1WB0__s_$S#a_$ _0$_>$_7/__u_a/__c_wa;Yb,n0auaU,pxl#V,l4l S,l7l$Q,dirl-Bm-R-$m .P/txno4;b+aaU,px#V,l4 S,l7$Q,dir-B-R-$ .P/txn4;lc 1a$bU,px#,l4  ,l7$P,dir-B--$ .S/txn40ptrP0endVG+0bBbUH..Kcc >H~.Lcc H.McH[/cHJ /cH4 H H.vdHwH 1\ 4dI HQ#dH;0JnowLm?LRAL3CDeEroS UH 7-oBTGQqFpz #D#E##F#9 '-{5 '- i?(%# /( # ( # b ( # (# (# O(# (# z(# (#$ (#( + (#, M(]#0 0(c#4 .(%#8 >(%#< (#@ ("E#D (#w#F H($i#G b((y#H (1#L (7#T d(8#X (:%#\ !(<#`  (] ((]# (c#B (%#&{ y   3% %$[E ##   R#J# # 0 w{W!ڥ#ۺ#n #" #TnW  #! #2E47YG o p# >    b # .. ~    #  .#  .# bit %#u32 "7 * +4#key ,~# n #p #" - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 57#8 6#< 7#@ 8%#D6]4"w "x#"y#"z7#  "{7#L'"|7#r"}7#8"~7#j?"7# -"7#$u"6#( F |)8J K7#* L7#{M#fdN%# j?O7#expP7#4Q&#c5R&#4S&# u5T&#$ibUu #(obUu #,x V7#0W#4  Fu # Uj?}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#,7#0 7#4H%#80)^ #< >#@>#A^#DJ #L  #P  #T #X, 0tstru#lenv%#  u  ^ p z #L # # #fe #be # %# j? %#$Z 7#(req u #,rep u #0si %#4 #$ # 6#srv #\ #Q #> &#txn # %# +$# &#2 )&## ~# ~#, %# 7#  & %#J&!%# &"%#&# # d ] k auid^1#gid_#`&# buxa  LfdM%# N%#TO%#>P#  Q #R%#%$S%#T7#U#V#)W&#kAX#&Y#LZ# [7#b #)c#  TQum,#n%#So%#p%# q# r# s%#$4t&#(5u&#,vL#0wL#4gxL#8,yL#<hz#@e{%#H|#L  &%% < L% <sCfA&#bBu #.(?cbC#{D# E>#evF># G0#H#I%#  JQ#$ R Q J8%#get%#put%#u%# #6E<_L`#c@aK#setbK#clrcK# AdK#L@eK#remf]#clog]#4hz# 9i#$Bj#($k#,Gl#0um#4n%#8K%%6]Qtt%Wc%tt5%8len%97#cr%:7#%;7#8N %Cv%D8#8%E~#%F~#)%G~#m3%H~# $    D $>$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#<$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#Y$rq$st$D$P $7#sol$#eol$#som$7# col$7#sov$7#eoh$7#cap$#sl$<#  $^#8 $%#@$3$#N$# ${ #req$Y#rsp$Y#\uri$# $#$#I$%#j?$7#) R##%#W# #:: !a!^#!_,#k!`,#!ae + ,# -# .%# /# E :< ##QI*'lD# #O# %# T%#r%#%#6#B!#,acl#0#8#@#Hs>!#Psrv #\e %#`? %#dh y"#hY#Z #%##%#7#%#g%#[# %#R %##%#%#қ#G #R%#7%#v-###%#ٲ#&z##id#4+#t#t%#4 %#%#7#w7#7#7# *#7#+*# 7#p#p# p#%$7#7#`7##z#### %#8#%#7#j7# <#p#p# p# p# p# p# ) p# p# Qp# %#cap%# \6# ? 6#  %# o #  # m # u # Jw# w# %# %# %#  %# %# u%# %# B%# p # # %# Z%# $# ]$# # # ]#  $#  $# %# w #  %# !$# = "%# #%# $7# %7# F&5!# :&5!#HaE &7#f 7#7#p7>4un5{in66p2u7a#  ;  #! #srv" #  ?"J # K%#* L%#M%# N%# O#B P#'R#S%# T%#$5 T%#(%$U7#,6U7#0tV%#44 V%#8'W%#<tX#@}!Y#H>[6#L\\6#\?^6#l`%#|oa# bQ#@d #d #e#o f6#wg~#h%#i%#;i%##j%# j%#>j%#k%#l%#Fm%#ido#p7#b p7#q7#r7#us7#+t7#Vt7#gu# v #hw #yp#yp#jz7# {<#}p#}p#~p#~p#p#.*# 7#p# p#p#Qp#U%#5!x ,|}#t0~#t1~#9 # #%# 0%#$ %#(!G#len7#pos7# sid7#srv #oe#src#buf #!beu!  7#<#)" srv)"# %# %# T"Xact #bck #,y"act#bck#h#%#Q %# %#%# %#%#8 %#  #map!# /"#,VT"#T t##W7t##8t##/t##t##t# h## %#O3%#8%#:%# ?%# %#\%#}!%#!v-#!! # $ +${ $D  %# G# G# / G# # #  #$k% W#(} W#,, W#0 p#4Q p#<S% px #sv Ǯ # ~#D ~# j? 7# iid %#I %#sid %#j% " #% iid %#px #buf 7#sid 7# ptr %#bol %#% (( $ S% j% &F & &)&  &p&,SC,O%#,P%#T,Q%# ,R%# 'e ,;uid,<%#gid,=%#,>%#%$,?%# ,,@%# ,A%#!,B%#a,C%#,D%# h,E%#$ ,F%#(<,G#,',H#0,I#44+,I#8J,J%#<,J%#@,K%#D,K%#H,L%#L ,L%#Pm ,M#Tu ,M#,S/&# ,T #g,U%#"e(5L%PbbU#5L%S#5Le(Q#5L%R#5Le(V$lenL,W#j?LWP%,LS&(5%bdU'si p'bu S(}5 %l( %h)ret %Q)max %d*)4=dheU'si< S"t*4%pe*lU$fd%+si p+bu S+ret%Q+max%W%%l%5%h%4%d,"tj,48j,8#Pg-)dfyf)fwdD%R.)(85%V/)t*gh0*V1*/=**Hhh1*1*2 3*V3*Q4*4*3*V5*ii0+R0+P5+ii0,+P17+6*h7tg7fg76*A5h%7bgu 7sig 8fdi%8retj%8maxj%9j%9k%6+#W%7nowV%:&V%6C+w"L%7nowK%:&K%*i+W50llU'si S;,5%loU'fd%)si W)bu S(%p,"n,8#m,4Gm/,*imm0+R0+P5+xmm0,+P17+/0,,mm1,/N,t*mm0*S1*/,*enn0+V0+R5+yn}n0,+R17+5t*nn0*S1*6,4D%:C%*- 5XomqU'siW W)ibYu V)obZu S)fd[%p/G-*pp0+R0+P5+pp0,+P17+/-*pp0+R0+P5+pp0,+P17+5*q'q0+R0+P5+!q%q0,+P17+*-4pqqU'si R)ibu P*/i5q7tU'si V)obu S(%P,8#&r/N.,rr1,/.*rr0+W0+R5+rr0,+R17+/.t*rs0*S1*/.*Msbs0+R0+P5+\s`s0,+P17+5*ss0+R0+P5+ss0,+P17+<['$/pEm ?ER AE3 C D^Ero S UH  09 -5 -i? ~#/ # #b #  # #O # #z #  #$ #(+ #,M #00 #4. ~#8> ~#< #@ ">#D #p#FH $ #Gb (#H 1#L 7#Td 8#X :~#\! <#`     #  # B ~#   / 3qFcz D E# F#oBTGQ n #p #"  - #ref !#x]4w x# y# z0# {0# L'|0# r}0# 8~0# j?0# -0#$ ux#(   b#    ### bit~#u32"0?* +#key, # H0wq1#rq2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D?))  R# # ~# P# #:] R]# ]#< # #)2>40YG o  p# $[ >*   # *# : q R # J #  q#  w !# ۺ# n # " # 7 |)8!J !K0# * !L0# {!M#fd!N~# j?!O0#exp!P0# 4!Q# c5!R# 4!S# u5!T#$ib!U #(ob!U #, x !V0#0 !W#4 # !U j?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H~#8 0) #< 7#@ 7#A W#D J#L #P  #T  #X4 0tstru#lenv~#E E  K  p z "# L"# "# "#fe" #be" # "~# j?"~#$ Z "0#(req" #,rep" #0si""#4 ":# $":# "#srv"x# \"x# Q "x# > ""#txn"# "~# "!# ""# 2"## # "w# "w# ,"ם"# "0#4    ]: Tn  # !: # J k} auid ^y#gid _c#  `n# bux aJ  Lfd M~# N~# T O~# > P:# Q#  R~# %$ S~#  T0#  U#  V# ) W# kA X# & Y# L Z# [0#  b} # ) c# T Q u m#  n~# S o~#  p~# q# r#  s~#$ 4 t#( 5 u#,  v#0  w#4 g x#8 , y#< h z#@ e {~#H  |#L  ~~~  ~CfA#bB #n.(?cbCn# {D# E7#evF7# G~# H# I~# J#$ ~  J 8~#get~#put~# u~# #p7>4un5 in6p2u7#_(S C(O~# (P~# T(Q~# (R~# e (;uid(<~#gid(=~# (>~# %$(?~# ,(@~#  (A~# !(B~# a(C~# (D~# h(E~#$ (F~#( <(G#, '(H#0 (I#4 4+(I#8 J(J~#< (J~#@ (K~#D (K~#H (L~#L  (L~#P m (M#T u (M# (S# (T # g(U~# a ^# _%# k`%#a`e+ ,`# -f# .~# /# l 5%8len%90#cr%:0#%;0#N %Cv%D# 8%Ew# %Fw# )%Gw# m3%Hw# q L$!!!! ! !!!! ! D $$l$~#m_l$~#u$~#u_l$~# v$~#v_l$~#$l$~#v_l$~#c$~#c_l$~# r$~#r_l$~#"$rq$Wst$D$ P $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$#sl$# $W#8  $~#@l$ 3$L# N$# $ #req$"#rsp$"#\uri$# $# $# I$~# j?$0#E  &0# f 0# 0# "x?I Jx# K~# * L~# M~# N~# O# B P# 'R # S~# T~#$ 5 T~#( %$U0#, 6U0#0 tV~#4 4 V~#8 'W~#< tX#@ }!Y#H >[#L \\#\ ?^#l `~#| oa# b# @dx# dx# e# o f# wgw# h~# i~# ;i~# #j~# j~# >j~# k~# l~# Fm~#ido# p0# b p0# q0# r0# us0# +t0# Vt0# gu# v # hwx# yi# yi# jz0# {/# }i# }i# ~i# ~i# i# .l# 0# i# i# i# Qi# U~# 'lDR # # O# ~# T~# r~# ~# # B$#,acl#0 #8 #@ #H s>$$#Psrvx#\ e ~#` ? ~#d h $#h Y# Z # ~# # ~# 0# ~# g~# [# ~# R ~# # ~# ~# c# G # R~# 7~# v-L&# # ~# ً# &%#id# 4+# t# t~# 4 ~# ~# 0# w0# 0# 0# l# 0# +l# 0# i# i# i# %$0# 0# `0# # z# # # # ~# 8# ~# 0# j0# /# i# i#i#i# i#i#) i#i#Qi#~#cap~#\#? # ~#o #  #m #u #Jp#p#~#~#~# ~# ~#u~#~#B~#p `#`#~#Z~#X&#]X&#]# ]#]]#^&# ^&#~#w # ~#!n&#= "~##~#$0# %0#F&##:&##H~!; # # # #!E #srv#"x# !D" "~# ":# ":# /":# "# "#  "#$ k%"P#( } "P#, ,"P#0 "i#4 Q"i#<*""px"ƿ #sv"x# "w# D"w# j?"0# iid"~# I"~#sid"~#A" " ""Ͷ#""iid"~#px"ѿ #buf"0#sid"0# ptr"~#bol"~#""(("˳!"*""A" "  "E "#E "QI#x ,| }#t0~#t1~# 9 #  # ~# 0~#$ ~#($ :#len0#pos0# sid0#srvx#oe #src:#buf #$$be uI$  0# <#|$ srv|$# ~# ~#x$Xact ##bck ##,$act#bck#% ~# Q ~# ~# ~# ~# ~# 8 ~# x#mapI$# $#, V$# T %# W7%# 8%# /%# %#%x%F&  ~# O3~# 8~# :~# ?~# ~# \~# }!~#v-F&! R& n& ~& #"'c6W~@tuU$6X~%&"'Rtt&3''@&3'(&X)='R*J'vt}t+['%'e'tt,v'P+'*'tt+'-J'".t/.__p-e'n60t-'w"L~0nowK~1&K~2'@1 #(26#~u9vU$6$~3,6%~4s&xS4p' W5_u v$x6/~V$"6/~p#(5g@vwU6tf4ph p$6i(l$6jS$)jW4ik~h%((vv,(P+ )%(e'vv,v'P+'7(wHw.lent~'p3j}c-){k~1j~0nowj~#),E~wwU86P8B6P3W63]65ww3%3%9)w xU8W6S9m*5xxU4p S%W*m*Jxx+~*%**Jxex+***Qxex+***Qx]x+***exx+***lxx+ +**lxxx,*P*+xx, +Q-*"0t-* ~0t}-* v0tu2*]1\*-*0t-+0t2*+0t:[7+:J 7+:L7+;4] ;4 ;  ~ :.v+:w~ +< :&Q+:';0=now'<::e (X_:(^ >'> : Q0:R0: U0: V]:W*$G6P?>bx09!0Ei "0@;e&ik5int60>Em?ERAE3CD^EroS UH 0oBTGQqFpz $D$E#$F#9 +-{5 +- i?,# /, # , # b , # ,# ,# O,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 >,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7#T d,8#X ,:#\ !,<#` 7 6 B  , ,,# ,#B ,#I{B3$[> ## 8R#J#8#Hwty6 7# w8#2>40YtG o p#!ڽ#ۊ#n ܠ#" #73 b3#CC  # C# C# bit#u32"0*+I#key,#n#p#" - #ref!# H0wq1#rq2# 3#04#450#86#< 7#@8#D K]4"w "x*#"y#"z0#  "{0#L'"|0#r"}0#8"~0#j?"0# -"0#$u"K#([ )|)8&J &K0#* &L0#{&M#fd&N# j?&O0#exp&P0#4&Q;#c5&R;#4&S;# u5&T;#$ib&U #(ob&U #,x &V0#0&W#4 5 5[) # &Uj?#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$>#0#(#0#,#0#0 #0#4H##80)#s #< #7#@#7#A#W#DJ#5#L #5#P # #T# #XA 0#tstr#u#len#v#   s p #z%#L%# %# %#fe%"#be%"#%# j?%#$Z %0#(req% #,rep% #0si%$#4 %#$%#%#srv%B#\%B#Q %B#> %$#txn%# %#%"#%$#2%$## %w#%w#,%g$#%0#  y  ] Tn  #! # k auid^1#gid_#`&# buxa  LfdM# N#TO#>P#  Q #R#%$S#T0#U#V#)W%#kAX#&Y+#LZ# [0#b #)c#  TQum1#n#So#p# q# r# s#$4t%#(5u%#,vQ#0wQ#4gxQ#8,yQ#<hz#@e{#H|#L  % AQ AxCfA%#bB #.(?cbC#{D# E7#evF7# G#H#I#  J\#$W\ J8#get#put#u# m# AE<_L`#c@a[#setb[#clrc[# Ad[#L@e[#remfm#clogm#4h# 9i#$Bj#($k#,Gl#0um#4n#8V V A m Va   bs   p7>4un5 in6p2u7#:0SC0O#0P#T0Q# 0R# e 0;uid0<#gid0=#0>#%$0?# ,0@# 0A#!0B#a0C#0D# h0E#$ 0F#(<0G#,'0H#00I#44+0I#8J0J#<0J#@0K#D0K#H0L#L 0L#Pm 0M#Tu 0M#0S# 0T #g0U# ) R###P# #:O a ^# _%#k `%# ae+,#-#.#/# Z O< ##   (E &0#f 0#0#g5)8len)90#cr):0#);0#N )Cv)D#8)Ew#)Fw#))Gw#m3)Hw# ((           D (e(l(݉#m_l(މ#u(߉#u_l(߉# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(eD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(#sl(#  (W#8 (#@#(3(#N(g# ( #req(#rsp(#\uri(# (#(#I(#j?(0#mD.( -(#idx(#val(# #(# |t!B? I JB# K#* L# M#  N# O#B P#' R"# S#  T#$5 T#(%$ U0#,6 U0#0t V#44 V#8' W#<t X#@}! Y#H> [#L\ \#\? ^#l `#|o a# b\#@ dB# dB# e#o f#w gw# h# i#; i## j# j#> j# k# l#F m#id o# p0#b p0# q0# r0#u s0#+ t0#V t0#g u# v"#h wB# yi# yi#j z0# {<# }i# }i# ~i# ~i# i#. # 0# i# i# i#Q i#U #|"'lD R # #O # # T #r # # #B %#,acl #0 #8 #@ #Hs> %#Psrv B#\e #`? #dh &#hY #Z # Ɖ# # ȉ# 0# ʉ#g ˉ#[ # ͉#R Ή# # Љ# щ# Ұ#G #R ԉ#7 Չ#v- (# # ؉# #& '#id #4+ #t #t #4 # # 0#w 0# 0# 0# # 0#+ # 0# i# i# i#%$ 0# 0#` 0# #z # # # # #8 # # 0#j 0# <# i# i#  i#  i#  i#  i# ) i#  i# Q i#  #cap # \ # ? #  # o #  "# m # u # J p#  p#  #  #  #  # # u #  # B # p #  #  # Z #  (# ] (#  #  # ] #  !(# !(#  # w #  #  !1(# = "#  ##  $0# %0# F &K%# : &K%#HH"; '' #'! #srv'"B# }#D% %#%G# %G# /%G#%#%#  %#$k%%P#(} %P#,,%P#0%i#4Q%i#<#%px%Ɖ"#sv%B#%w#D%w# j?%0# iid%ʉ#I%ʉ#sid%ʉ# $ %"%#g$%iid%Љ#px%щ"#buf%0#sid%0# ptr%ԉ#bol%Չ#$%((%}#%#% $$[" $ $ $ 5$K%x , | }#t0 ~#t1 ~#9 "# "# # 0 #$  #(%  G#len 0#pos 0# sid 0#srv B#oe "#src #buf #% be "u  &   0#< #?& srv ?&# # #Bj&X act $#bck $#,& act #bck #~'  #Q # # #  # #8 # B#map &#  E&#,V j&#T '#W7 '#8 '#/ '# '# ' B~' (  ۉ#O3 ܉#8 ݉#: މ# ? ߉# #\ #}! #v- (! (1( A( (%*dow*#h1*#m1*#h2* #m2*#(*min*i#max*i#0%*ˉ#%*̉# )*>*Ϡ#L*Р#>)*i*ȉ]*͟($*(%*A(h)*ptr*str*reg*h)O)%,**#val* )#ptr*>)#8%*0# len*ډ#$j?*ۉ#(* *p*i*ll*id**a* *QI*n*$0*i*#ptr*#len*#j?*# ctx*)#*$%*kw*# **# c%*+# ?B*+# *0# &* #* $ * +n)*$+ "  $+ +*++A* *!#kw*"+#arg*%+# %*&# %*'#**+ + *++%* *#kw*+#+n*!"+*%#str*$n*$,H;xyU%px"&op&totW'kl&curBQ'8BV(|,&maxɉh)*vω+,;My|zU%pxL"Q&srvNBR,,"z6z-,-,.,D7;/ :/6:+-6izzU%pxh"R+q-7{zB{U%srvzBS&p|"V09{,,zz-,-,+-8P{{U%srvBS&p"V09w{,,i{w{-,-,$G.6{"}U%p"W&srvBS'Z;V&actp&bckl1|}2w`1}}3t 4J/j980}q~U5srv7BS2p9"W2grp:J/P69e~67b~7.,S}[}-,-,7.,[}{}-,-,(.8x RBR7 /,}}-,-,76/P/S~e~-^/,i/S~e~9v/P,/e~q~-/$:i/;I;sHB0,7PU5p"V2srvBS?:70,-,-,,,09:0W-F04]19U5sBQ3p"2grpJ/R7%1]12F-k1)@u1P7<11Pd-1,1h-1)@1P:17;sB3grpJ/:17x;swB:1q:~;s}B3grpJ/4d27r‚U5srvqBS2ps"V2grptJ/W69ǁ67732,Áǁ-,-,7O2,-,-,)8x BP43:ЂZU5srvBW?l7?62p"p2grpJ/l72,-,-,72,%-,-,7!3P/ۃ-^/,i/ۃ9v/PAI38A8Q?67u3P/-^/,i/9v/P73P/-^/,i/9v/V,,0(9:0S-F044K8k`ÅU5sjBV7 44--4,i/9v/S,84-F4:84<9X;sWB:Q4:a;s`B4F58yЅU5srvxBS2pz"V696774,-,-,74,-,-,(4 8x BR75,m-,-,7254--4,i/9v/P,F5-T5:_53:R;sQB4 6R7ۇU5srvBS2p"V696775,߆-,-,75,-,-,(588x BP,84-F446W:U5srvBS?l7?62p"p7r6, -,-,76,@-,-,7684߈-F4,4--4,i/-v/>:7:ɊU5p"V2srv BS?:!7&7,`u-,-,,84-F4B77tBЊU5pxs"5urisVC#s8GuPp2pvS8M9wl89xhB89B ÎU5s P8GPT2txn8W2req V2msg8S2px"P890L8@,PR2lenPH8M9D2ctx#X2pS)P800W113c)h2hex0R18,PB96BЎU5s S8GPW3txn82msg8T2px"V890P2lenPS2ctx #X2p!Q189?LB>(;s&U5sr 8:uBp2errvV6Dout7 :>ِ-#>9,>P(%:2lenW7k:L>}.9]>W9g>D)@r>S@}>@@>V@>7:>k->9>W9>V)@>X@>R@>T7:>oߓ-?9 ?V-?(:@!?Q@*?P1E4?7;A?ߓp-S?9]?W(4;@i?P@u?\@?V7x;? -?,? -?,? 9?P-?)(@?S,@)N-@,$@)N-6@1)N@B@P,?AL9?P-?7n=M@p-_@9i@l(.<@@u@W@@h@@d@@V@@`F@7<@Д-@)`@@Q@@R,?Дݔ-?,?Дݔ-?,?Дݔ9?P-?7<@ - A)x@APA)=0qE@7=?0G9?P,?3G-?,?3G9?P-?,1Ym-17E=$AyΕ-2A->A,P/Εݕ-^/,i/Εݕ9v/P7=L>9]>W9g>P)@r>S@}>L@>V@>H7=?-?,?-?,?9?P-?,,09:0S-F0.6>8FGsF6>GpFA><> |G> H.>75BGpx4"/:4BH:6H66*srv7BH:7B.>_8BGpx"Guri/#HGP*cH7.A?:zBGpxx"/>yGleny*h{0*l{0I*__v0J?9BB;pA"=:AB3srvCB?:CB?D/I3sWB.?7// 6"J?6?= 5"IJ@?=*C=,F0.$@C//B/JM@T?=S?3tUCJ@;B;p"=:B3srvB?mB?:B3grpJ/?:K60J@8B;grpJ/?/3sBI?7/:$A6;;grpJ/?R:":IA:;grpJ/;sBBB;0U5s SAAę3__v*>AA3__v*>13__v*>1^3__v'>AA^i3__v'>1it3__v'>BEB8_;U5s^ V2p`$P2erraSBiD6@U5s 3fd2errP(IC8$ iDT2retP8j?L1a8/#'H2src(X7CoD֝9|DQ9DS7/CD=9DQ1=@D@1]c2__v=>P7`CD-D(C8$\iDW2ret]S8j?]S(C2msg7CDv|9DQ9DP7CD9 EP-E7 DoD}9|DQ9DS7,DoDZf9|DQ9DS7LDoDC9|DQ9DS,oDU9|DQ9DSV-#>-,>7ED9DR9DP7EDԧا9 EP-E,EF '-RF<F. (Gs 'B($5err( C(CQ("AG?1%?1%A,Gը?5%?5%ARG?9%?9%(G8?=%?=%)P?=8=P(Hh2arg>S7GwIv-I,Iv-I-I-I7HwI-I,I-I-I-IA]H?D%?D%1?D8DPAH?L%?L%7HwI -I,I -I-I-I,wI 3-I,I 3-I-I-IAIkx?]%?]%A4I?i%?i%)2begyV3endy1ͫګ?%?%LI7 i= hLI -= +=x += ,MaJ;$U5px"S5l4  5l75dirCB$+VC$+W1֬?%?%MK60U5px"S5l4  5l75dirCB$+WC$+V8I:BR1av?%?%MKv7U5px"S5l4  5l75dirCB$+VC$+W11F?%?%M%L9U5px"S5l4  5l75dirCB$+VC$+W1֮?%?%ML_;  U5px "S5l4  5l7 5dir CB $+VC$ +W1Qf? %? %MIM9 U5px "S5l4  5l7 5dir CB $+VC$ +W1ѯ? %? %MM,8-  U5px+ "S5l4+  5l7+ 5dir+ CB, $+VC$, +W1Qf?2 %?2 %M{N8E IU5pxC "S5l4C  5l7C 5dirC CBD $+VC$D +W8;F P1Ѱ?L %?L %N 9q PbUO[+NpOJ +NOL+NO~-LNN ~O-MNO qbO.vNxOwOPO.Q OO/;0Qnow/"OOg*1.O OO-10O OO/11O OO 2Q0O2R0O 2U0O 2VO2W/8%b +'BZp0; 0Ei "0@;e&ikint60>Em?ERAE3CD^EroS UH 0oBTGQqFez "D"E#"F#9 %-p5 %- i?&~# /& # & # b & # &# &# O&# &# z&# &#$ &#( + &#, M&R#0 0&X#4 .&~#8 >&~#< &#@ &">#D &#p#F H&$^#G b&(n#H &1#L &7#T d&8#X &:~#\ !&<t#`   &R &&R# &X#B &~#p n   3 $[ >   # #    R #J # #  w2>40YG %ao p;#!ڏ#0#n F#" # 7    b #  9    #  #  # bit ~#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H0wq1D#rq2D# 3~#04~#450#86R#< 7#@8~#DLLL<]4!w !x#!ym#!z0#  !{0#L'!|0#r!}0#8!~0#j?!0# -!0#$u!#(  |)8J K0#* L0#{M#fdN~# j?O0#expP0#4Q#c5R#4S# u5T#$ibU0 #(obU0 #,x V0#0W#40 # Uj?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#80) #< 7#@7#AW#DJ#L #P % #T+ #X_ 0tstru#lenv~#p p 0 v  p zm#Lm# L#  #feC#beC#~# j?~#$Z 0#(req0 #,rep0 #0siP$#4 #$#a#srv#\#Q #> `$#txne# ~#"#r$#2$## w#w#,&$#0#_   < ]e Tn  #!e # u k auid ^&#gid _# `# bux au  Lfd M~# N~#T O~#> P#  Q # R~#%$ S~# T0# U # Vm#) W #kA XR#& Y #L Z# [0# b #) c# T Qu m # n~#S o~# p~# q# r#  s~#$4 t #(5 u #, v #0 w #4g x #8, y #<h zm#@e {~#H |m#L   ~~ ~  ~  CfA #bB0 #.(?cbC#{D# E7#evF7# G#H#I~#  J#$   J8~#get~#put~#u~# #G5$8len$90#cr$:0#$;0#N $Cv$D#8$Ew#$Fw#)$Gw#m3$Hw# #    D #E#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#E_D#P #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#_#sl##  #W#8 #~#@#3##N#G# #6 #req##rsp##\uri## ####I#~#j?#0#V) R##~#P# m#:X a^#_%#k`%#age+,#-#.~#/#  $< #6#00V$QII'lD # F#OF# ~# T~#r~#~#a#B #,aclm#0m#8m#@m#Hs>1 #Psrv#\e ~#`? ~#dh  #hY#Z #~##~#0#~#g~#[# ~#R ~##~#~##G #R~#7~#v-Y"##~#m#&!#id#4+#tm#t~#4 ~#~#0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0#F#zF#F#F## ~#8#~#0#j0# 1#i#i# i# i# i# i# ) i# i# Qi# ~#cap~# \a# ? a#  ~# o #  C# m # u # Jp# p# ~# ~# ~#  ~# ~# u~# ~# B~# p # # ~# Z~# e"# ]e"# a# a# ]a# k"# k"# ~# w #  ~# !{"# = "~# #~# $0# %0# F&# :&#HE &0#f 0#0#p7 >4un5< in6ap2u7# !H;  m#!p #srv"# ?"J# K~#* L~#M~# N~# O#B P#'RC#S~# T~#$5 T~#(%$U0#,6U0#0tV~#44 V~#8'W~#<tXm#@}!YL#H>[a#L\\a#\?^a#l`~#|oa# b#@d#d#e#o fa#wgw#h~#i~#;i~##j~# j~#>j~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#+t0#Vt0#guD# v#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#Hx ,|}#t0~#t1~#9##~# 0~#$ ~#( <#len0#pos0# sid0#srv#oeC#src#buf+ #1 beC uV  0#<m# srv # ~# ~# Xact#bck#, act#bck#!~#Q ~# ~#~# ~#~#8 ~# #mapV #  #,V #T !#W7!#8!#/!#!#!!S" ~#O3~#8~#:~# ?~# ~#\~#}!~#v-S"! _" {" "6 <#D ~#<# <# /<###  #$k%P#(} P#,,P#0i#4Qi#<#pxC#sv#w#Dw# j?0# iid~#I~#sid~## "͘#&$iid~#pxC#buf0#sid0# ptr~#bol~#P$ ((<# γ# # `$ r$p f$$p x$"$;,~pU#si+Q$$qw%$P%$R&${k~'j~(nowj~)%"<6ʱU#si5R)~%;DбmU#siCQ#msgC~%S*h%%۱%%R$%G%%R% 6 +%1(buf~0 )g& <UpU#siTS#msgT~%Q*%g&{%t&P*&%,%*&&ò,&*S&&в%&Q%&P$&߲%&P,&$&,&+&;(buf0 +&'(buf0 &&#W~(nowV~'&V~&&w"L~(nowK~'&K~+'%(buf0 -[%'e-J %'-.v/'-w~ S'. -'QB'-(;0- )Q0-)R0- )U0- )Va-)W'Di5D 0P<0Ei  "0@;e &ik 5int 60 >Em ?ER AE3 C D^Ero S UH  0oBTGQqFpz !D!E#!F#9 +-{5 +- i?,# /, # , # b , # ,# ,# O,# ,# z,# ,#$ ,#( + ,#, M,h#0 0,n#4 .,#8 >,#< ,#@ ,">#D ,#p#F H,$t#G b,(#H ,1#L ,7#T d,8#X ,:#\ !,<#` 7  ,h ,,h# ,n#B ,#1{  *  3  #3#4#G#5##6# #7# 3 #8##9#!#:#N}", "-# ".#s!"/#"0N#  $[ >   _# #   R _#J # #  wtm,w1x#"y#tz#|{# @|#T}#8~#l## #$#(2>40YG o p#!_#ۦ#n ܼ#" # ,7 O bO# __ ,  4# _# _# bit#u32"0*+e#key,# n #p #7" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D7g]4w x$#y#z0#  {0#L'|0#r}0#8~0#j?0# -0#$ug#( w E |)8%J %K0#* %L0#{%M#fd%N# j?%O0#exp%P0#4%QW #c5%RW #4%SW # u5%TW #$ib%U #(ob%U #,x %V0#0%W#4Q Q wE  # %Uj? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #80) #< 7#@ 7#A W#DJ Q #L Q #P  #T #X]  0 tstr u#len v#     p  z$#L$# $# $j#fe$> #be$> #$# j?$#$Z $0#(req$ #,rep$ #0si$F"#4 $#$$#$#srv$#\$#Q $#> $V"#txn$M# $#$ #$h"#2$"## $w#$w#,$"#$0#   & #J&!# &"#&# #  ] Tn  _#! # * k] auid^1#gid_#`&#p buxa* w LfdM# N#TO#>P#  Qd#R#%$S#T0#Uj#V#)W#kAX#&Y#LZ# [0#b] #)c#d TQum#n#So#p# q_# rT# s#$4t#(5u#,v#0w#4gx#8,y#<hz#@e{#H|#Lwp p  dCfA#bB #N.(?cbCN#{D# E7#evF7# G^#HT#I#  J#$ ^ j J8#get#put#u# "#d) R###P# #:T a^#_%#k`%#a!e+,#-#.#/# _ T< ##55)8len)90#cr):0#);0#N )Cv)D#8)Ew#)Fw#))Gw#m3)Hw# (    D (3(l(݉#m_l(މ#u(߉#u_l(߉# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(3MD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(N#sl(#  (W#8 (#@(3(#N(5# ( #req(#rsp(#\uri(# (#(#I(#j?(0#"E &0#f 0#0# 1 ?IJ# K#* L#M# N# O#B P#'R> #S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tX#@}!Y#H>[#L\\#\?^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# vD #hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#1> 'lDRj# #O# # T#r###B##,acl#0#8#@#Hs>##Psrv#\e #`? #dh Œ$#hY#Z #Ɖ##ȉ#0#ʉ#gˉ#[# ͉#R Ή##Љ#щ#ҵ#G #Rԉ#7Չ#v-֟&##؉##&%#id#4+#t#t#4 ##0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0##z#### #8##0#j0# <#i#i# i# i# i# i# ) i# i# Qi# #cap# \# ? #  # o #  > # m "# u "# Jp# p# # # #  # # u# # B# p # # # Z# &# ]&# # # ]# &# &# # w #  # !&# = "# ## $0# %0# F&H## :&H##H4 ; '' #'! #srv'"# 2!D$ $#$G# $G# /$G#$#$#  $#$k%$P#(} $P#,,$P#0$i#4Q$i#<!$px$> #sv$#$w#D$w# j?$0# iid$ʉ#I$ʉ#sid$ʉ#! $"$#"$iid$Љ#px$> #buf$0#sid$0# ptr$ԉ#bol$Չ#F"$!(($2!!$Ω!!$! V"w J h" \"" Q n"QI"p7!>4jun5 in6"p2u7"#H#x ,|}4#t0~4#t1~4#9D #D ## 0#$ #(#G#len0#pos0# sid0#srv#oe> #src#buf ##be> !u $  0#<#<$ srv<$# # #g$Xact"#bck"#,$act4#bck4#{%#Q # ## ##8 # #map $# B$#,Vg$#T %#W7%#8%#/%#%#%{%& ۉ#O3܉#8݉#:މ# ?߉# #\#}!#&v-(#(#&)#*#+# 4++#5,#j?-#-.'#/'# 0&#$&"! & & & ' 1$1%#kw1&# 1-0'#0'N> > '^' 1516#kw17^'# m'& ' '###m'' '##G#'((-SC-O#-P#T-Q# -R# )e -;uid-<#gid-=#->#%$-?# ,-@# -A#!-B#a-C#-D# h-E#$ -F#(<-G#,'-H#0-I#44+-I#8J-J#<-J#@-K#D-K#H-L#L -L#Pm -M"#Tu -M"#-S'# -Tp #g-U##,'=< ҶU$>:N~$:<: $w<:> $l';> %err;$;&5*'>%'>%&+(su? ~)@S**0'^%'^%+0'^)^P**8K'b%'b%**Sf'f%'f%* +n'q%'q%&"+)}r,P*h+ƴ'Z%'Z%+ƴ'Z)ZP,+,-,.,-,-,--/H)"g-P*+Ub'%'%*+jw'%'%&=,h'%$.,-,.,-,-,--,q,,-,.,-,-,--,,,-,-,--/)&0~(resP 0,n1m0- -1+1x+N1,2Q-f<U%msgQ-$8  3.=obU4sn 4pxn>  4urin&R5repp d5svq`5svsq\5msgr h&-6G<*_.6}'S7len~+8%8%+86P&.6}<?./6$0P&.06}<./`6$0P . 3~/<Kp U4sJ V4repJ  4uriJ&W7pxL> 5msgM h5upN0S,S/~/ -/,j/~/-/./-/9/+:buf ;/`<U:nTP2B0<iU%s V%rep W%uri& (msg¬ h(up0Q,.0~/-/.~/[]-/=v0<6pU4s5 S4rep5  =k1<xU4s W4rep  5msg ,0~/-/*0?P8j&$1x5pn8< .k1>|1P*>1)47__v>*X17__v>/8j;1=[:tZ=2J=U4s 4rep  ?25msg @&15es2~,2~/-/&{28=6<~.206-2- 3-3-!3>-3~/A93~AE3Q&2@5pnP35tm.`3Ph>n3~>z3P.~/nu-/ 2 H#BP3:=JCoutHQ-18HCerrI21-ICptrI7endK7cL7 `3 -D3"Cnow!3Ctm!3 <E<UF.*K33 >F~*L33 ~F*M3F[+3pFJ +3F.v4FwF -\ ?4G FQ.4 W4GFd4 L4?'>> F.;0Hnow.GFe -X((Hpid-ZFX-[F-^ F/F/F, 0F Q0FR0FUS0FcT0F U0F VFWT56r'6'6H0>!0Ei  "0@;e &ik 27 5int 60 >Em ?ER AE3 C D^Ero S UH  0o BT G QqF= >> 0z #D#E##F#9 +-/5 +- i?,# /, # , # b , # ,# ,# O,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 >,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7$#T d,8$#X ,:#\ !,<#`5 7@ :$W c $ , ,,# ,#B ,#jc3$[> ##" YR#J#Y#iwy6 7# w8#Tn  #!#k 2> 40YG o p#Z!##n #" Z#j7 b#j  r# # # bit#u32"0!*+#key,#FnF#pF#!u" - !#ref!F# H0wq1#rq2# 3#04#450#86#< 7$#@8#D u]4"w "xK#"y!#"z0#  "{0#L'"|0#r"}0#8"~0#j?"0# -"0#$u"#( |)8$J $K0#* $L0#{$M$#fd$N# j?$O0#exp$P0#4$Q#c5$R#4$S# u5$T#$ib$U #(ob$U #,x $V0#0$W$#4   # $Uj?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#80) #< 7#@7#AW#DJ#L #P  #T #X 0tstru#lenv# $  $ *  p z!#L!# # 0#fe#be## j?#$Z 0#(req #,rep #0si!#4 "#$"##srv#\#Q #> '!#txn# #R#9!#2P!## ‚#Â#, #0#    ]# auid ^<#gid _&# `1#6 bux a = Lfd M# N#T O#> P"#  Q*# R#%$ S# T0# U0# V!#) WF#kA X#& YL#L Z$# [0# b# #) c#* T Qu mR# n#S o# p# q# r#  s#$4 tF#(5 uF#, vr#0 wr#4g xr#8, yr#<h z!#@e {#H |!#L= 6 F 6br *bCfAF#bB #.(?cbC#{D$# E7#evF7# G$#H#I#  J}#$$x} J8#get#put#u# #* ) R###P# !#:  a ^$# _%#k `%# aoe+,o#-u#.#/:# *{ < F##  5'8len'90#cr':0#';0#QN 'Cv'DQ#8'E#'F#)'G#m3'H# &    D &W&l&ݔ#m_l&ޔ#u&ߔ#u_l&ߔ# v&#v_l&#U&l&#v_l&#c&#c_l&# r&#r_l&#r&rq&st&D&P &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&U#  &W#8 &#@&3&#N&# & #req&r#rsp&r#\uri&# &#&#I&#j?&0#E &0#f 0#0# ?IJ# K#* L#M# N# O#B P#'R#S# T#$5 T#(%$U0#,6U0#0tV#44 V#8'W#<tX!#@}!Y#H>[#L\\#\?^#l`#|oa# b}#@d#d#e#o f#wg#h#i#;i##j# j#>j#k#l#Fm#ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# v#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#'lDR0# #O# # T#r###B'#,acl!#0!#8!#@!#Hs>$'#Psrv#\e #`? #dh '#hY#Z #Ɣ##Ȕ#0#ʔ#g˔#[# ͔#R Δ##Д#є#Ҁ#G #RԔ#7Ք#v-L)##ؔ#!#&(#id#4+#t!#t#4 ##0#w0#0#0# #0#+# 0#i#i# i#%$0#0#`0##z#### #8##0#j0# G#i#i# i# i# i# i# ) i# i# Qi# #cap# \# ? #  # o #  # m %# u %# Jp# p# # # #  # # u# # B# p o# o# # Z# X)# ]X)# # # ]# ^)# ^)# # w #  # !n)# = "# ## $0# %0# F&&# :&&#HrR; %% !#%!$ #srv%"#  D #h# h# /h###  #$k%P#(} P#,,P#0i#4Qi#<z px#sv#Ȃ#DȂ# j?0# iidʔ#Iʔ#sidʔ# "L# iidД#px#buf0#sid0# ptrԔ#bolՔ#!!(( !z !֑ '! 9! $ -! P! $ ?!!%)dow)#h1)#m1)#h2) #m2)#!)min)i#max)i#0%)˔#%)̔# ")>)#L)#S")i)Ȕ!])ʹ!!$)!!%)V!}")ptr)$str)reg)}""%,))!#val) "#ptr)S"#8%)Q# len)ڔ#$j?)۔#(# )p)$i)ll)id)#a)"#QI2#$#$0)i)#ptr)#len)#j?)# ctx)"##$%)kw):# ) $# c%)$# ?B)$# )0# &) #$ E $ L"#9$  $ $ 9$ $?$$A) )!!#kw)"%#arg)%$# %)&# %)'!#2#$$ $ $$$%) )!#kw)$#$# "%)%#str)$#$m%acl)* )+!# u),# B)-!# ).# )/0#%%C)> )?!# g)@!#pol)A# )B0# -)C#%p7!>4un5in6 &p2u7%#&x ,|}r#t0~r#t1~r#9### 0#$ #('h#len0#pos0# sid0#srv#oe#src"#buf #$'be!uI'  0#<!#|' srv|'# # #'Xact &#bck &#,'actr#bckr#(#Q # ## ##8 # #mapI'# '#,V'#T (#W7(#8(#/(#(# ( (F) ۔#O3ܔ#8ݔ#:ޔ# ?ߔ# #\#}!#v-F)! R)n) ~) s%) 1$1%#kw1&:# 1-)#)    )* 1516!#kw17*# *) a*/SC/O#/P#T/Q# /R# +e /;uid/<#gid/=#/>#%$/?# ,/@# /A#!/B#a/C#/D# h/E#$ /F#(</G#,'/H#0/I#44+/I#8J/J#</J#@/K#D/K#H/L#L /L#Pm /M%#Tu /M%#/S *# /T6 #g/U#,>($(%!#lD(&~)#('# ?,? => >#= ?R#%m,> F! G]!> H,!j? I],{> Bop D]#v J?,#&-=nLU'fdmV(j?mS(3>m-($m-)>oX)>pW*retqP)>t+u-,__s~$^-~! ~0!~>!~7,__u~-,__c~w-)?m,H)?m,.X*__s$R-! 0!>!7,__u-,__cw4--&.=PiU( 0V( (/>/>S*fdS*errd*msg:`0.1.2."T3fdS4. >(pU5 '*R6 )0S7err*V8/=:!U5 90Q8F/>H0U5 G0Q9K0I>gU:sf$ V:reqf W6JhK0S6f=ip;/Q0y0{k?j3nowj20;3buf 20(3buf >0#W3nowV?&V>0w"L3nowK?&K43i>hU5>5:< 5w<5l':err57ptr:l7val0p6*?Q+1@%@%+1$1@%@%=36h6>d7polQ6lD~)S@JK0+]2Lg@%@%+2r@%@%=2@%@%.@/6P+2@%@%-U7aclm%P6u:Q;+33<3P;D33<3P;]33<3P;v332<3P;33^r<3P;3313;3313038J13>3 2:?'14_4=2pU:px0:l40$ P:l70$:dir05B19$5$1$R4r5n=FU:pxD:l4D$ P:l7D$:dirD5BE9$5$E$6Gp6 ?GV69>GR6H/S/>P/A>.6fQ69fl6=fh6=fd6=f`A=UB~*L55 B*M5B[+5BJ +5B.v5Bw5CB-Q5D'>B.;0Enow.M= `6r')06%$4JL0@$0Einti "0@;e&wk60>Sm?SRAS3C7DlEroS7 U7H 0oBTGQqFez 'D'E#'F#  n # p #e" - e# ref !#R]4&w &xR#&ye#&z0#  &{0#L'&|0#r&}0#8&~0#j?&0# -&0#$u&X#( h ! %%#u%#Z%># len% ># H%!>#\E%"#h2L40YG o p#$[L[ '#[# k R'#J##  w!'##n #" # E 0Tn! ! '#!!0# @ k hp 7 > 42un 5in 6p 2 u 7@# b#   ### bit>#u32 "08 * +# key ,# H 0 wq 1# rq 2# 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#`#  buxa L fdM># N>#TO>#>Pk#  Q #R>#%$S>#T0#U#Ve#)W%#kAX#&Y+#LZ# [0#b#)c#  TQum1#n>#So>#p># q'# r# s>#$4t%#(5u%#,vQ#0wQ#4gxQ#8,yQ#<hze#@e{>#H|e#L%>>> A Q> A,SC,O>#,P>#T,Q># ,R>#  e ,; uid,<># gid,=>#,>>#%$,?># ,,@># ,A>#!,B>#a,C>#,D># h,E>#$ ,F>#(<,G#,',H#0,I#44+,I#8J,J>#<,J>#@,K>#D,K>#H,L>#L ,L>#Pm ,Mh#Tu ,Mh#,SW# ,T#g,U># |)8(J (K0#* (L0#{(M# fd(N># j?(O0# exp(P0#4(Q #c5(R #4(S # u5(T #$ ib(UE #( ob(UE #,x (V0#0(W#4    E # (Uj? }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#80) .#< E#@ E#A e#DJ #L #P  y#T #X t 0 t str u# len v>#  E  .p  z e#L e# # # fe # be # ># j? >#$Z 0#( req E #, rep E #0 si &#4 k#$ k# # srv s!#\ s!#Q s!#> &# txn # ># $# &#2 &## …# Å#, &# 0#t y  ) >#J)!># )">#)#y# 4 ]5+8len+90#cr+:0#+;0# N +C v+D #8+E#+F#)+G#m3+H# k*    D *&* l*># m_l*># u*># u_l*># v*># v_l*>#$* l*># v_l*># c*># c_l*># r*># r_l*># A*rq*vst*D*P *0# sol*# eol*# som*0# col*0# sov*0# eoh*0# cap*# sl*$#  *e#8 *>#@*3*k#N*# *K # req*A# rsp*A#\ uri*# *#*#I*>#j?*0#) R##>#^# e#:' #a#^##_%#k#`%##awe"+",w#"-}#".>#"/# 2'< ##9 --g5 --i?.>#/. #. #b . #  .#.#O.# .#z.# .#$.#(+ .#,M.#00.#4..>#8>.>#<.#@."L#D .#~#FH.$#Gb.(#H.1#L.7#Td.8#X.:>#\!.<#`. ..# .#B .>#n  g  3C fA%# bBE #s.(? cbCs#{D# EE# evFE# G#H#I>#  J#$  2 J8># get># put>#u># g#QI0'lD# #O# ># T>#r>#>##Bx"#, acle#0e#8e#@e#Hs>"#P srvs!#\e >#`? >#dh >##hY#Z #>##>#0#>#g>#[# >#R >##>#>#҈#G #R>#7>#v-־$##>#e#&?$# id#4+#te#t>#4 >#>#0#w0#0#0# 0#0#+0# 0#w#w# w#%$0#0#`0##z#### >#8#>#0#j0# 1#w#w#w#w# w#w#) w#w#Qw#>#cap>#\#? # >#o # #m h#u h#J~#~#>#>#># ># >#u>#>#B>#p w#w#>#Z>##]## #]#$# $#>#w # >#!$#= ">##>#$0# %0#F&!#:&!#HgE &0#f 0#0# v ;  e#! # srv"s!# s!?"Js!# K>#* L>#M># N># O#B P#'R#S># T>#$5 T>#(%$U0#,6U0#0tV>#44 V>#8'W>#<tXe#@}!Y#H>[#L\\#\?^#l`>#|oa# b#@ds!#ds!#e#o f#wg#h>#i>#;i>##j># j>#>j>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#+t0#Vt0#gu# vy!#hws!#yw#yw#jz0# {1#}w#}w#~w#~w#w#.0# 0#w# w#w#Qw#U>#!x ,|}# t0~# t1~#9y!#y!#># 0>#$ >#(x"<# len0# pos0# sid0# srvs!# oe# srck# buf# "be u"  0#<e#"  srv"# ># >#s!#X act!# bck!#,># act# bck#-$>#Q ># >#># >#>#8 ># s!# map"# "#,V##T 9$#W79$#89$#/9$#9$#9$s!-$$ >#O3>#8>#:># ?># >#\>#}!>#!v-$ $ $K %D  ># <# <# / <# 7# 7#  7#$k% ^#(} ^#,, ^#0 w#4Q w#< & px # sv s!# ȅ#D ȅ# j? 0# iid >#I ># sid >##& " ͐#& iid ># px # buf 0# sid 0# ptr ># bol ># & (( ˕%  & #& & v& &&  &"'?;U# V#!s!S$'?/@U%s. V&txn0'p&fe1l'"2'R')2'S(''~)(*(P+'6}&h[S,' -ji,'( -jo.f&hUS/(8F>0sF(0pF&(!(,(1?>U$|(C?U%s V'8@eQR2(?>CU%s V%si S&reqE P&repE Q3(C[))) )4@ 5)P6%)J^7tv1I%)7tv2I%)8retK^+)<2)?>PU%s V%si W())*)P))()'A`)()(3')()(/)w"L>0nowK>9&K>"`*?=U:s< V:si< W;req>E p;rep?E S(G*`*)m*)x*3`*)m*)x*<*,0bufE 98>",p?f<U:se V:sie S(*())) )4` 5)P(+())) )4x 5)P,L+ =#8q>P3,S)#,3-,Zf*:,Q)E,(u+(*C))) )4 5)P(+,)#,3-,*:,R)E,(+'"U)()((+(y))) )4 5)P(,W,)d,3W,)d,<-,.(0s's!1)2MU:t1;s3 V=)4>p=)50l=)50h?u)?9)5?'  ,D- @j?031_f)1,o-8!=j?0R31X[)1(-1)1(-1F)1)1(-1Fe*1R*1W31e*1R*1W(-1)1*1S(.1)1)1(4.1)1)1(K.1)1(v.1)1*1W4p!51R(.1)1*1W4!51R(.2%)2) 23(*)W) )4!5)P(.,2,)92(/,2')92()/E2GQ)R2+C/@j?0(Z/E2$0)R2(q/,202)92(/'*(S*(P(/^2  )k2(/u2  *2P*2Q(/u2 7 *2P*2Q(0u2? V *2P*2Q({0^2V  )k2(>0u2` w *2P*2W(^0u2|  *2P*2W3u2  *2P*2W,0!;len*>P(0(@ x ))) ).@ x 5)P(02  )232  )2(12  )232  )2(S1 3 / )33(3 / )9332  *2P(j1C3/ V )P3.<  8len><1%0bufE <1)u0buftE /1"u>0t1t>0t2t><2'c0bufbE 98@b0-'d0A,2?7s 7si 9j>0nowj>/2"0t/2 ~0t}/2 v0tu<3 ]9 \3/(30t/C30tP;err>S;fin>RBZ %%Be ,XB y>B,^B[-3BJ -3B.v4Bw> ;4C B/Q*4B;0Dnow<<B $B0#Ej (  E, )e B1>B Q0BR0B U0B VBW3=Oy\0@d58len9d#cr:d#;d#EN CvD#8E#F#)G#m3H# % 3@3\U len3 cr3 :W +@3 e%V new3Q intk&P`0@Ei "%@;e&^kint6%>:m?:RA:3CDSEroS UH % 9z DE#F#G7 [JG[# k9 @JDoBTGQ[ 3   # #   R #J z# # " w( 234%Y-G 8to pN#!ڗ#C#n Y#" # , 9 -g5 - i?s# / #  # b  # # # O# # z# #$ #( + #, M#0 0#4 .s#8 >s#< #@ "3#D #e#F H$#G b(#H 1#L 7#T d8#X :s#\ !<#` # #B s#t  m  3 b#  `  # # # bits#u32"%*+#key,`#n#p#: H0wq1k#rq2k# 3s#04s#45%#86P#< 7#@8s#DJJJ:]4w xg#y#z%#  {%#L'|%#r}%#8~%#j?%# -%#$u#(  |)8J K%#* L%#{M#fdNs# j?O%#expP%#4Q#c5R#4S# u5T#$ibU. #(obU. #,x V%#0W#4. # Uj? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#80) Q #< ,#@ ,#A L#DJ #L #P  ] #T c #XE E . K p 4  W t ] Tn  #! # k auid^#gid_v#`# buxa  LfdMs# Ns#TOs#>P#  Q #Rs#%$Ss#T%#U #V#)W #kAXP#&Y #LZ# [%#b #)c# TQum #ns#Sos#ps# q# r# ss#$4t #(5u #,v/ #0w/ #4gx/ #8,y/ #<hz#@e{s#H|#L   ss s  / s  V CfA #bB. # .(?cbC #{D# E,#evF,# G #H#Is#  J #$ 5    E<_L`#c@a #setb #clrc # Ad #L@e #remf #clog #4h# 9i1#$BjC#($k1#,Gl1#0um"#4ns#8 s s s    s 1s!C7qp7>4un5t in6tp2u7I# SCOs#Ps#TQs# Rs# Ie ;uids#%$?s# ,@s# As#!Bs#aCs#Ds# hEs#$ Fs#(<G#,'H#0I#44+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm Mq#Tu Mq#S# T #gUs#^@'s`Ufd& Rdir&sQf (P@,sUfd+ Pdir+sR@2sUfd1 Pdir1sRTA8sUfd7 Rdir7sP!ret9sP :PG@As@Ufd@ Pdir@sR!retBsP"! CP#s@J@dUfdIsP#>@SpUpRexpRsR ITsS!fdUsW!iUsQ Vh @Wsd AXsV |@XsS!fdsYs` Z_$  P$!- P%Tf&&'fh&&({ks)js*nowjs(+&s*nows*exps@sUpV+@+S@+@+@ 1@sS#@,UpSj@s0:Up#@@U!pR,[,J ,drs 2 ,t",.vLV ,ws p- , Q_,;%,e X,s, Q%,R%, U%, VV,Wk  k @ @&Rx0WAintC{AC#SZSE@#A,%A0a!ՂEi ";e&k6>m?RA3CD roS UH   S _ %qF p oBTGQz #D#E##F*#24YG o p#$@[E #E#US R#J##Sw!##n #" #S9 -5 -i?%#/ # #b  #  ##O# #z# #$#(+ #,M#00#4.%#8>%#<#@"#D ##FH$#Gb(#H15#L7K#Td8K#X:%#\!<#` K # #B %#  S S3( b(#88S   #8#8# bit%#u32"*+>#key,# n #p # " - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @]4"w "x#"y#"z#  "{#L'"|#r"}#8"~#j?"# -"#$u"@#(PS |)8 J K#* L#{ MK#fd N%# j? O#exp P#4 Q0#c5 R0#4 S0# u5 T0#$ib U #(ob U #,x V#0 WK#4 * * P  #  Uj? }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0 #4H %#80) h #< #@ #A #DJ *#L *#P  t #T z #X 6 0 tstr u#len v%#    h p  z #L # # #fe H#be H# %# j? %#$Z #(req  #,rep  #0si P!#4 U#$ U# #srv #\ #Q #> `!#txn W# %# # r!#2 !## # #, &!# ؂#    n  S] Tn  #! # Sk auid^#gid_u#`# buxa  LfdM%# N%#TO%#>PU#  Q #R%#%$S%#T#U#V#)W#kAX#&Y #LZK# [#b #)c# TQum&#n%#So%#p%# q# r# s%#$4t#(5u#,vF#0wF#4gxF#8,yF#<hz#@e{%#H|#L   % %   %6SF% 6mCfA#bB #.(?cbC#{DK# E#evF# G#H#I%#  JQ#$LS Q J8%#get%#put%#u%# ,# EA %#kAM#p7>4un5 in6p2u7#) R##%#Z# #: X a ^K# _w#k `w# a%e+,#-#.%#/j# c  X< ##    95&8len&9#cr&:#&;#N &Cv&D#8&E#&F#)&G#m3&H# %           D %7%l%%#m_l%%#u%%#u_l%%# v%%#v_l%%#%l%%#v_l%%#c%%#c_l%%# r%%#r_l%%#%rq%st%7QD%P %Ԃ#sol%#eol%#som%ׂ# col%؂#sov%؂#eoh%ق#cap%Q#sl%#  %#8 %%#@ %3%#N%9# % #req%#rsp%#\uri%# %#%#I%%#j?%#,E &#f ##;!S?IJ# K%#* L%#M%# N%# O#B P#'RH#S%# T%#$5 T%#(%$U#,6U#0tV%#44 V%#8'W%#<tX#@}!Y#H>[#L\\#\?^#l`%#|oa# bQ#@d#d#e#o f#wg#h%#i%#;i%##j%# j%#>j%#k%#l%#Fm%#ido#p#b p#q#r#us#+t#Vt#gu# vN#hw#y#y#jz# {_#}#}#~#~##.# ## ##Q#U%# ;H'lDR# #O# %# T%#r%#%##B"#,acl#0#8#@#Hs>"#Psrv#\e %#`? %#dh U##hY#Z #%##%#ɂ#%#g%#[# %#R %##%#%#ҹ#G #R%#7%#v-$##%#ټ#&V$#id#4+#t#t%#4 %#%##w### ##+# ### #%$##`##z#### %#8#%##j# _##### ##) ##Q#%#cap%#\#? # %#o # H#m #u #J##%#%#%# %# %#u%#%#B%#p ##%#Z%#$#]$## #]#$# $#%#w # %#!$#= "%##%#$# %#F&"#:&"#H   ; $$ #$! #srv$"# < D  %# # # / # # #  #$k% Z#(} Z#,, Z#0 #4Q #<  px H#sv # #D # j? ɂ# iid %#I %#sid %# " #&! iid %#px H#buf ҂#sid ӂ# ptr %#bol %#P! (( <  γ  `!PS T r! f! ! * x!QI"x ,|} #t0~ #t1~ #9N#N#%# 0%#$ %#("#len#pos# sid#srv#oeH#srcU#bufz #"beHu"  #<## srv## %# %# 0#Xact!#bck!#,U#act #bck #D$%#Q %# %#%# %#%#8 %# #map"#  ##,V0##T P$#W7P$#8P$#/P$#P$# P$  D$$ %#O3%#8%#:%# ?%# %#\%#}!%#v- $!  $$S % S"L%A U#6%$__s"K%$__s#K&q%dA( U'sig'%S&%AB4U'sigA%P(kAAMR"%.A]@U)sig^%R*sA^%V*4+_%P*A`l~ W+[& +J &+L&+.v0& m+w%T&,S+'QC&-%@ &WS-As&` &%S-A&@ -Al`% <0Us/-0+B0Ei "0@;e&ik5int60>Em?ERAE3CD^EroS UH 09 %-&5 %-i?&#/& #& #b & #  &#&#O&# &#z&# &#$&#(+ &#,M&+#00&1#4.&#8>&#<&#@&">#D &#p#FH&$7#Gb&(G#H&1#L&7#Td&8#X&:#\!&<M#` 7    &+ & &+#  &1# B &#&G]3 n #p #]"  - ]#ref !#qFo BT G Qz D E# F#2>40YG Mo  p'#$[>  X# #  RX# J# #w( !X# # n 2# " (#87 [  b [#kk8   @# k# k# bit #u32 "0 *  +q#key ,#j H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7#@  8#Dzz zj]4w x# y]# z0# {0# L'|0# r}0# 8~0# j?0# -0#$ u#(/ |)8J K0# * L0# {M#fdN# j?O0#expP0# 4Q# c5R# 4S# u5T#$ibU^ #(obU^ #, x V0#0 W#4  /^ # U j?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H#8 0)G #< 7#@ 7#A W#D J #L  #P S #T Y #X 0tstru#lenv#  ^  G p z ]# L]# z#  #fe#be# # j?#$ Z 0#(req^ #,rep^ #0si!#4 # $# #srv# \# Q # > !#txnD# # A# (!# 2?!# # w# w# , # 0#  M j ] Tn  X# ! # k auid^#gid_# `# buxa  LfdM# N# TO# >P# Q # R# %$S# T0# U # V]# )W # kAX# &Y # LZ# [0# b # )c# TQ um# n# So# p# qX# rM# s#$ 4t #( 5u #, v%#0 w%#4 gx%#8 ,y%#< hz]#@ e{#H |]#L     % LCfA #bB^ #.(?cbC# {D# E7#evF7# G# HM# I# J0#$+c0 J 8#get#put# u# #)  R# # # P# ]#:6 a ^# _%# k`%#ae+ ,# -## .# /# ) W< # i# c cWE  &0# f 0# 0#p7>4cun5j in6p2u7#&5"8len"90#cr":0#";0#wN "Cv"Dw# 8"Ew# "Fw# )"Gw# m3"Hw# !           D !}$!l!݉#m_l!މ#u!߉#u_l!߉# v!#v_l!#{!l!#v_l!#c!#c_l!# r!#r_l!#!rq!st!$>D! P !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!>#sl!{# !W#8  !#@! 3!# N!&# !d #req!#rsp!#\uri!# !# !# I!# j?!0#!?I J# K# * L# M# N# O# B P# 'R# S# T#$ 5 T#( %$U0#, 6U0#0 tV#4 4 V#8 'W#< tX]#@ }!Yz#H >[#L \\#\ ?^#l `#| oa# b0# @d# d# e# o f# wgw# h# i# ;i# #j# j# >j# k# l# Fm#ido# p0# b p0# q0# r0# us0# +t0# Vt0# gu# v# hw# yi# yi# jz0# {# }i# }i# ~i# ~i# i# .o# 0# i# i# i# Qi# U#'lDR  # 2# O2# # T# r# # # B>"#,acl]#0 ]#8 ]#@ ]#H s>\"#Psrv#\ e #` ? #d h ##h Y# Z # Ɖ# # ȉ# 0# ʉ# gˉ# [# ͉# R Ή# # Љ# щ# .# G # Rԉ# 7Չ# v-ք$# # ؉# ]# &$#id# 4+# t]# t# 4 # # 0# w0# 0# 0# o# 0# +o# 0# i# i# i# %$0# 0# `0# 2# z2# 2# 2# # # 8# # 0# j0# # i# i#i#i# i#i#) i#i#Qi##cap#\#? # #o # #m #u #Jp#p#### # #u##B#p ###Z#$#]$## #]#$# $##w # #!$#= "###$0# %0#F&!#:&!#H@A;    ]#  ! #srv "# D # # # /# # #  #$ k%P#( } P#, ,P#0 i#4 Qi#<i px#svǷ# w# Dw# j?0# iidʉ# Iʉ#sidʉ#  "͈# iidЉ#px#buf0#sid0# ptrԉ#bolՉ#!((i ր !/  (! ! ?! .!!x ,| }@#t0~@#t1~@# 9# # # 0#$ #(>" #len0#pos0# sid0#srv#oe#src#bufY #\"beu"  0# <]#" srv"# # #"XactE!#bckE!#,#act@#bck@## # Q # # # # # 8 # #map"# "#, V"# T ## W7## 8## /## ## # #~$  ۉ# O3܉# 8݉# :މ# ?߉# # \# }!#v-~$! $$ $d %C+#?]#g#@]#pol#A##B0#-#C#$s%%#dow##h1##m1##h2# #m2##%#min#i#max#i#0%#ˉ#%#̉#%# >#2# L#2#&#i#ȉ]#s%$#Ѻ%%#%<&#ptr#str#reg#<&&%,# #]#val#%#ptr#&# 8%## len#ډ#$ j?#ۉ#(& #p#i#ll#id#&a#&QI&B'$0#i##ptr##len## j?## ctx#&#'$%#kw## #'#c%#\(#?B#w(# #0#&# #'  ' B&''   ' V('V(A##!]#kw#"(#arg#%(# %#&#%#']#&'w( V( 'b((%##]#kw#(#(B'!"(#%#str#$B'$,)acl#*#+]#u#,#B#-]#  #.##/0#g)C#3#4]#acl#5g)#neg#6# ()4C#9#:]#5B#;]#%))u'#B()#)&<*C<U'px:'l4:  'l7:'dir:(B;'($;V(P&*EG0U'pxE'l4E  'l7E'dirE(BF'($FV(P&+BT0FU'pxR'l4R  'l7R'dirR(BS'($SV(P)X+D`PZU( _(D_' (0_ )+Ag`jU'pxe'l4e  'l7e'dire(Bf'($fV()+bCmpwU($lV((Dl' )>,(EtU($sV(S(Ds'Q*$2u),CU($V(V(D'P+BS,ret-A+ZCS),DU($V(S(D'Q*$2)%-LCuU($V(P(D'V*$2)-6E@U($V(S(D' *$2ɉ.endW.cS/-!+,ԉR-*,ԉ&e.D@U($V(W(D'R(*s+;Bl+$2h.cW.endd.psV.plS/P."0, 1("2, P3.BU4$V(P4D'R3.B(U4$'V(P4D''R3/E.MU4$-V(4D-' 3W/'C6PyU4$5V(R4D5'Q5s7W/R23/CDU4 CS4DC'W40C 6lenE7/ CPU8ptrP3<0EBW4U4 VP4DV'V40V 2X<&S2$2YP3,2Cw@tU4 vV4Dv' 40v 5ixiVW5jy0Q2)y0p2 y0l5ptrzS910~%0~%-0~2~P9a10%0%-02P/1@"0%0%1X"02P/1p"0%0%1"02P-#;0%0%-#;02P34C"U4 V4D' 40 5iih5j0V2)0d2 0`5ptrW930%0%-02P9M30%0%-02P/3"0%0%1"02P/3"0%0%1"02P-^ v 0%0%-^ v 02P3`4A!""U4  P4D 'P40  :4C-""U8kwl,4P}(:47D5##U8kwl44P1#0j63/5B>g) #`#U4u=W4b=V5acl?g)S-3#B#0A%0A%35CK(`# $U8kwJ0HL2BMP5kwlN4W75D_$\$U8pat^'S;5Ds'`$$U4Br'W<5k$$= 6-n$$>6P>#6V?06wBl@bk6patm'6tmpm'37C'$}&U4>VAtC$AB@&AD5&2B'\2^B(X2D'S20`2nBW5argT/6#6end0D-%#&5retR3o7dBg)&&U8aclg)2B'S2A'V-&&0j37ODg)&(U4>V4DWAtC 'AA'ADw'2Dg)R2A'S2uV38DDg)()U4CCCW4DC AtCl)AAi(ADg(2DFg)R2AG'S2uHV2HIV-0(B(0L%0L%39Cr% ))U4lDq%2Ds9W2qDs9p2Bt9P2DEt9Sm),)38:(D%)2+U4>4D 8polPAtC*AD*A B*5arg`5negW2DV2Dg)\2B9S2YD9X2lD%T-G*_*0%0%-G*_*02P3H;cD@+,U4lD%P8px 8l4 8l78dirA{D8+2D92B92B'S5aclg)P2D'W2$&2D2D2A-++6__s 3;Bag),-U4lD`%P4B`0V2Db9S2Bc9R5acldg)PBSB -/-UC.$K;; >C~$L;; ~C$M;C[%<CJ %<C.v(<LCwL<DC'Q;<i<i< 0EA<@e Y<+B/}(<< )FB)<c <2%v}(&X@00-0E0Einti "0@;e&wk60>Sm?SRAS3C7DlEroS7 U7H 0oBTGQqFez  D E# F# n# p#e" - e# ref!#R]4w xR#ye#z0#  {0#L'|0#r}0#8~0#j?0# -0#$uX#( h n 2L40YsG ~o p#$[L ##  @R#J#@# P w!#ۉ#n ܟ#" # E 9 -C5 - i?># / #  # b  # # # O# # z# #$ #( + #, M#0 0#4 .>#8 >>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ !<#` # #B >#J  C  3   b #  6    #  #  # bit >#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj|)8J K0#* L0#{M# fdN># j?O0# expP0#4Q#c5R#4S# u5T#$ ibU0 #( obU0 #,x V0#0W#40 # Uj? }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#80)  #< E#@ E#A e#DJ #L #P  % #T + #X_ 0 t str u# len v>#p p 0 v  p  z e#L e# # # fe # be # ># j? >#$Z 0#( req 0 #, rep 0 #0 si #4 #$ # P# srv #\ #Q #> # txn # ># # #2 !## …# Å#, ׮ # 0#_   < ]e Tn  #!e # u k a uid^&# gid_#`# buxau  L fdM># N>#TO>#>P #  Q #R>#%$S>#T0#U #Ve#)W #kAX#&Y #LZ# [0#b #)c# TQum #n>#So>#p># q# r# s>#$4t #(5u #,v #0w #4gx #8,y #<hze#@e{>#H|e#L   >> >  >  C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$   J8># get># put>#u># #0p7>4un5< in6PIp2 u7#) R##>#^# e#:I a^#_%#k`%#a0e+,0#-6#.>#/h# < j< #|#vvj5#8len#90#cr#:0##;0#N #C v#D#8#E##F#)#G#m3#H# ]"           D "" l"># m_l"># u"># u_l"># v"># v_l">#" l"># v_l"># c"># c_l"># r"># r_l">#3"rq"hst"D"P "0# sol"# eol"# som"0# col"0# sov"0# eoh"0# cap"# sl"#  "e#8 ">#@}"3"]#N"# "6 # req"3# rsp"3#\ uri"# "#"#I">#j?"0#E &0#f 0#0# s!?IJ# K>#* L>#M># N># O#B P#'R#S># T>#$5 T>#(%$U0#,6U0#0tV>#44 V>#8'W>#<tXe#@}!Y#H>[P#L\\P#\?^P#l`>#|oa# b#@d#d#e#o fP#wg#h>#i>#;i>##j># j>#>j>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#+t0#Vt0#guA# v#hw#yw#yw#jz0# {1#}w#}w#~w#~w#w#.}# 0#w# w#w#Qw#U>#'lDR # #O# ># T>#r>#>#P#B"#, acle#0e#8e#@e#Hs>5"#P srv#\e >#`? >#dh "#hY#Z #>##>#0#>#g>#[# >#R >##>#>#A#G #R>#7>#v-]$##>#e#&## id#4+#te#t>#4 >#>#0#w0#0#0# }#0#+}# 0#w#w# w#%$0#0#`0##z#### >#8#>#0#j0# 1#w#w# w# w# w# w# ) w# w# Qw# >#cap># \P# ? P#  ># o #  # m 0# u 0# J~# ~# ># ># >#  ># ># u># ># B># p 0# 0# ># Z># i$# ]i$# # # ]# o$# o$# ># w #  ># !$# = "># #># $0# %0# F&!# :&!#H; !! e#!!p # srv!"# D  ># <# <# / <# 7# 7#  7#$k% ^#(} ^#,, ^#0 w#4Q w#<;  px # sv lj# ȅ#D ȅ# j? 0# iid >#I ># sid >#R " ͐#  iid ># px # buf 0# sid 0# ptr ># bol >#  ((  ;  R   p  !p !QI!x ,|}# t0~# t1~#9##># 0>#$ >#("<# len0# pos0# sid0# srv# oe# src # buf+ #5"beuZ"  0#<e#"  srv"# ># >#"X act!# bck!#," act# bck##>#Q ># >#># >#>#8 ># # mapZ"# "#,V"#T ##W7##8##/######W$ >#O3>#8>#:># ?># >#\>#}!>#v-W$! c$ $ $6 "%UE0--U#u#80V#j?0$\ES$HR$*W%O 0&f%E-t.U$ME>$HS'out-(0#$)R$V"%EU..U#\ETS)retVP*%Ej./U#\EiV$)kP$kS"&iE /q/U#\ES(H#%j*b&wE/@0U$HS$ ^V$^W$aE>p+[o&+J o&+Lo&+.v&+w> &, +$Q&$|Ee$[(31@00EEi @;e&Skint3CzDHEroSz UzH %z  D E# F# $[ 36   # 6# F 9 -Q5 - i?h# / #  # b  # # # O# # z# #$ #( + #, M"#0 0(#4 .h#8 >h#< o#@ "3#D #Z#F H$.#G b(>#H 1#L 7#T d8#X :h#\ !<D#` " "# (#B h#Q >  T 3"|)8J K%#* L%#{M# fdNh# j?O%# expP%#4Q4#c5R4#4S4# u5T4#$ ibU#( obU#,x V%#0W#4..T"# Uj? }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#80) #< ,#@ ,#A A#DJ .#L .#P  #T #X:p   ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    E &%#f %#%#<E %@00Uctr<R!%VE!%Qage"%PB|00T^iE=%a<%b<%E:%00Uctr9<SE9%Vv9%;%QE;%Rage<%PB00T^{EX%031UctrW<SEW% vW%Y%QEY%RGZ%ageZ%PB1 1T^[FJ .vwh  Q :%!now <b\2@10:FEinti @;kEr b#k y  # # # bit3# F@12U W ZK11`#1R X1Z1 X1Z1+7 Tl1o1f o1r1+7 s11 T11f 11+7 's11 @T11fQs11 vs11s11 FgF+F%*F%F%FF GF D1F FDtagO Jy3suF3 FF tagO YF22UsubnewV ~ 2a2Wx#R&2 .s22C 212CP Z=2@2+ qs@2C2#Q Ti2l2fR q2s2+7 s|22s22_WFsubnewbF!F_F_F_ P)!,F3 WX^E720FEinti @;kEr b#k y  # # # bit3# u32"% s32#3 ;* +#key,#oFo23U unewo .{2T3p#VlShT22f#&2331373B3F3P_#t3w333?  NFo unewooldo,F% FFG !FF F F! !FF FF FG FG!"ret]N #1Fu$ F%tag &y&3#F$ %tag &#G 3%x 3"r 3#Go4n5U unewo # 445pAq$MVYleSqh}dTe4h4f0$t4w44444PP$44"5.5#Go$ u%newo"oldo ,F% F F3 G !F F F F! !F F F F!"retN~F#op55U "uPx"Vj~q5s5'h$SPRT55fF{o zuxz|o F}y~HF(o56U 'uPx'V4H55Yd'$mSxPWRT66fFo uxo Fkeyy3F1o6E7U 0uPx0W2o( F3VT66f367APM3.7;7APM)N$*$,F%X`j7P70&GEi @;e&Sk2,int3CDHErH %=3>%9 -w5 -i?s#/ # #b  #  ##O# #z# #$#(+ #,M#00#4.s#8>s#<z#@"3#D #Z#FH$#Gb(#H1#L7#Td8#X:s#\!<#`   #  # B s#~  w  3 $[ 3&   # &# 6 4%G 6go  pA#5|)8 J K%# * L%# { M# fd Ns# j? O%# exp P%# 4 QG# c5 RG# 4 SG# u5 TG#$ ib U#( ob U#, x V%#0  W#4AAg5#  U j? }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#,  %#0 %#4 H s#8 0) #< ,#@  ,#A A#D J A#L A#P  #T #XMp   ]ss C f A# b B#.( ? cb C# { D# E,# ev F,# G#  H#  Is# J#$   ?= >>L# =?#>FG>Hj?I-{> B opD# vJ#5G"sP77U?#hfd$sP$__s&S& &%&3&,__u&__c&as[J . v ws  Q!a <70TGEi "%@;e&^kint6%>:m?:RA:3CDSErH % 0bG"fd#s# rH$l# LG%l#G7 RJ GR# b0 @J;oBTGQ[ 3   # #    R # J z#  #  w 234%Y$G /ko  pE# !ڎ# :# n P# " # , 9 -^5 -i?s#/ # #b  #  ##O# #z# #$#(+ #,M#00#4.s#8>s#<#@"3#D #e#FH$#Gb(#H1#L7#Td8#X:s#\!<#`  #  # B s#k  d  3 b#  W ### bits#u32"%* + #key,W#n#p#1 H0wq1b#rq2b# 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA1]4w x^# y# z%# {%# L'|%# r}%# 8~%# j?%# -%#$ u#(  |)8J K%# * L%# {M#fdNs# j?O%#expP%# 4Q# c5R# 4S# u5T#$ibU% #(obU% #, x V%#0 W#4% # U j?}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 0)H #< ,#@ ,#A L#D J#L #P T #T Z #X< < % B p +  N k ] Tn  # ! # k auid^#gid_m# `x# buxa  LfdMs# Ns# TOs# >P# Q # Rs# %$Ss# T%# U # V# )W # kAXG# &Y # LZ# [%# b # )c# TQ um # ns# Sos# ps# q# r# ss#$ 4t #( 5u #, v& #0 w& #4 gx& #8 ,y& #< hz#@ e{s#H |#L   ss s  & s  M CfA #bB% # .(?cbC # {D# E,#evF,# G # H# Is# J #$ ,    E<_ L`# c@a #setb #clrc # Ad # L@e #remf #clog # 4h# 9i(#$ Bj:#( $k(#, Gl(#0 um#4 ns#8 s s s      s  (s : .hp7>4un5k in6kp2u7@# S COs# Ps# TQs# Rs# @e ;uids# %$?s# ,@s#  As# !Bs# aCs# Ds# hEs#$ Fs#( <G#, 'H#0 I#4 4+I#8 JJs#< Js#@ Ks#D Ks#H Ls#L  Ls#P m Mh#T u Mh# S# T # gUs#^@*s77Ufd) Rdir)sQ77 +P@/s8 8Ufd. Pdir.sR@5s 8@8Ufd4 Pdir4sRKA;s@8u8Ufd: Rdir:sP!ret@V82;UpU expUs IWsp!fdXsS {GXsl iGYsS!fds[sh [sV!sr\sP!sw\sR!rn]%d!wn]%P$% P%:: P&::''(;;''){ks*js+nowjs)+&s+nows+exps@s@;;Up V,@ĵ;,S@;,sG; 1@sS#@;0<Up Sj@s0<:<Up #@@<<U!p R-[-J -drs ' -t-.vAM -ws e. - QT- ;%-e X-s- Q%-R%- U%- VM-Wb  b @ mH!1dCD<0KHEi "%@;e&^kint6%>:m?:RA:3CDSErH % oBTGQ[ 3O   # O# _  R #J z# #  w 234%G;LYG o p#H!##n #" H# X, 9 -c5 - i?s# / #  # b  # # # O# # z# #$ #( + #, M:#0 0@#4 .s#8 >s#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ !<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#L'|%#r}%#8~%#j?%# -%#$u~#(  \|)8 J K%#* L%#{ M#fd Ns# j? O%#exp P%#4 Qn#c5 Rn#4 Sn# u5 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  Uj? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#80) #< ,#@ ,#A L#DJ h#L h#P  #T #Xtp    ], Tn  #!, # < ko auid^#gid_#`# buxa<  LfdMs# Ns#TOs#>P_#  Qv #Rs#%$Ss#T%#U| #V##)W #kAX#&Y #LZ# [%#bo #)c#v TQum #ns#Sos#ps# q# r# ss#$4t #(5u #,v #0w #4gx #8,y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a E<_L`#c@a{ #setb{ #clrc{ # Ad{ #L@e{ #remf #clog #4h # 9i #$Bj #($k #,Gl #0um#4ns#8v sv s sa  v    s   s     p7>4&un5 in6p2u7 #ZSCOs#Ps#TQs# Rs# e ;uids#%$?s# ,@s# As#!Bs#aCs#Ds# hEs#$ Fs#(<G#,'H#0I#44+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #gUs# >ptr:fd;su32<u64=5G 7rH8#>#c,H*gH+%#fd,%#G"s<<U 8"sS!,"S^@Us="=U"fdTv Q"dirTs #fGg0=>U$ofsh!HisQ!gHjsS!jsR%chgksp%fdksW&f=='wS(('V)==*S+3H#s,G#s-op#s-fd#s,G#.,# /G >_>U"fdv Q HsS%ptrR5S@s`>>U"fdv p"dirs %ofsV!yHS!HR@s>?U"fdv p"dirs %ofsV!yHS!HR/s@ ?n?U"fdsW%ofsļS/ Hp??U"fdsV%ptrP/>@?AU"p "expsS.Is%fdsd! sp!iGsl0@:@'S'Q( ()@:@* W0,hArA(=(H&TAA(e(p+,G$s,G$s,rH$,H$s,&$s.,$+T{ks,js-nowjs+|&s-nows-exps1@sABU2p V3ZH3eB3=H5vB3G7B3G9B3G<B41@sS5@FBlCU2pE S1Hj@aspCCU2p` 6fdbsP1qGrsCCU2pq 5@CDU6p R7[X7J 7drs  7t7.v 7ws 8 7Q7;%7e XZ7s7 Q%7R%7 U%7 Vx7W!G/s!G0!_H1!@;!lH>!#H?s%evD  #s !Gc3fGOD0~HEi "%@;e&^kint6%>:m?:RA:3CDSErH % oBTGQ[ 3O   # O# _  R #J z# #  w 234%G;LYG o p#H!##n #" H# X, 9 -c5 - i?s# / #  # b  # # # O# # z# #$ #( + #, M:#0 0@#4 .s#8 >s#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ !<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#L'|%#r}%#8~%#j?%# -%#$u~#(  \|)8 J K%#* L%#{ M#fd Ns# j? O%#exp P%#4 Qn#c5 Rn#4 Sn# u5 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  Uj? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#80) #< ,#@ ,#A L#DJ h#L h#P  #T #Xtp    ], Tn  #!, # < ko auid^#gid_#`# buxa<  LfdMs# Ns#TOs#>P_#  Qv #Rs#%$Ss#T%#U| #V##)W #kAX#&Y #LZ# [%#bo #)c#v TQum #ns#Sos#ps# q# r# ss#$4t #(5u #,v #0w #4gx #8,y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a E<_L`#c@a{ #setb{ #clrc{ # Ad{ #L@e{ #remf #clog #4h # 9i #$Bj #($k #,Gl #0um#4ns#8v sv s sa  v    s   s     p7>4&un5 in6p2u7 #ZSCOs#Ps#TQs# Rs# e ;uids#%$?s# ,@s# As#!Bs#aCs#Ds# hEs#$ Fs#(<G#,'H#0I#44+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #gUs# >ptr:fd;su32<u64=5G 7rH8#>#aIe%#s1%#GEsDDU8EsS ,ES!HD EU"fdv S!IE`EU"fdsS#pos%V*^@s`EEU"fdv P"dirsQ#retsPu@sEFU"fdv S"dirs $+IE#i%P%@s FFU&fdv S&dirs '+IYF(i%R)s@&FFU&fd%sS) H0FFU&fd/sS)>@9F]LU&p8 &exp8sp*I:%*H;%*I<sl(eo<sh(fd=sP*H=sQ* >sd*H?s`*iG@sW*HAs\'H(F+ %**OsW,:^HH-S-Q../jHH0X+P@%(esQ,xJJ-"S.-.7.A1JJ0LS,XKK.i.t2KL..3 GGs4GGs4rHG 4HGs4&Gs5,G 3X3HFs4GFs6opFs6fdFs4GF 5,F3{ks4js6nowjs3&s6nows6exps%@2s`LkMU&p1 S'HLM'HN&M'GP8M'GSSM)$@]pMMU&p\ S%Zj@tsMNU&ps (fdusP%Gs NRNU&p )@`NOU(p R7[X7J 7drs  7t7.v 7ws "8 7Q7;%7e XZ7s7 Q%7R%7 U%7 V7W Hs Hs 8Is H5 H% lH   #Hs#ev Ki0IintEri @;e&dk3C/DYE6H 9 -G5 -i?!#/ # #b  #  ##O# #z# #$#(+ #,M#00#4.!#8>!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\!<#`   #  # B !#N 6 G 6 3cII!bIJ(IMdINRjIQILI  $CIElowE#E#CPsNllO}IP$9XIgUnfVWdfPQ'9=KU_`%judtpVRWlhWPQ% RPRVP#pIUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Im1m0 C![;!J ;\Zko 0IintEri @;e&dk3C/DYE6H 9 -G5 -i?!#/ # #b  #  ##O# #z# #$#(+ #,M#00#4.!#8>!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\!<#`   #  # B !#N 6 G 6 3cII!bIJ(IMdINRjIQILI  $CIElowE#E#CPsNllO}IP$JI[ UuZvZPQw\pJ(+\fpl%{`VW\DRPPXT8%P'LP4pIUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: I!m1m0"C#[L#J L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.? : ; @ &.? : ; @ '1(1).? : ; ' I *: ; I+.? : ; ' @ ,: ; I -: ; I ..? : ;' @ /: ;I 04: ;I 1 U2: ;I 34: ;I 44: ;I5 U617.? : ;' I 8: ;I94: ;I:1 ;.: ; ' I <.: ; ' =: ; I>.: ;' @ ?.? : ;@ @1A.: ; B.? : ;' I@ C4: ; I? < D!E4: ;I? < F4: ; I? < G4: ; I?  H4: ; I?  I4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I .? : ;' I@ : ;I 4: ;I 4: ;I  : ; : ;4: ;I% : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I &4: ; I ' (4: ; I) : ; * U+1,1-1. /.? : ;' I 0: ;I14: ;I 2 : ;34: ;I4 : ;5 : ;I64: ;I 7 U8.? : ;' I@ 9: ;I :: ;I ;1 <41 =.: ; ' I >: ; I?41@.: ;' I A: ;IB4: ; I? < C4: ; I?  D4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' @ $: ; I %&4: ; I'4: ; I (1)1 *.: ;' +: ;I,.? : ; ' I@ -4: ; I . /: ; I 0 U1 24: ;I 314.: ; ' I 5: ; I6.? : ;' @ 7: ;I 84: ;I 94: ;I:1;4: ;I<4: ; I? < =!>4: ; I? < ?4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' @ #: ; I $1%1&.: ; ' I ': ; I(.: ; ' ): ; I*.? : ; ' I@ +: ; I , U-4: ; I .4: ; I /101 1 241 3.: ;' I 4: ;I54: ;I6.? : ;I@ 7 8 : ;9 : ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; !I.? : ; ' @ : ; I 11 .: ; ' : ; I: ; I 4: ; I   4: ; I!.? : ; I@ ".? : ; @ #4: ; I$.? : ; ' I@ %4: ; I &.? : ; I@ '4: ; I? < (4: ; I?  )!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I & '4: ; I ( U)4: ; I*4: ; I+ ,4: ; I? < -4: ; I?  .!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I < : ;=4: ;I>.? : ;@ ?4: ;I@.: ; ' A1 B41C.: ;' I D: ;IE: ; IF.? : ;I@ G : ;H.? : ;' @ I4: ; I? < J!K4: ;I? < L4: ; I?  M4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I? < %!&4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".: ; ' @ #: ; I $1%1&1'.: ; ' I (: ; I).: ; ' I@ *4: ; I +4: ; I , U-1 .: ; I/4: ; I04: ; I1.: ;' @ 2: ;I 34: ;I 44: ;I 5.: ;' I@ 6 : ;7 U8 94: ;I:4: ;I;.? : ;' I@ < =41 >.: ; ' ?.? : ;I@ @41A B4: ; I? < C!D4: ; I? < E4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I % &4: ; I'.? : ; I@ (.? : ; ' @ )4: ; I*4: ; I +1,1-1.1 /.: ; ' I 0: ; I1: ; I 2 U34: ; I? < 4!54: ; I? < 64: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ;' @ #: ;I $.: ;' I@ %4: ;I &4: ;I '1(1) U*41+1,1 -41 . 1/.: ;' I 0: ;I14: ;I2.: ; ' I 3: ; I4: ; I54: ; I64: ; I7 : ; 8.: ; ' 9.? : ;' I@ :: ;I ; : ;< U= >4: ;I? @ A.? : ;' I B.: ;' @ C4: ; I? < D!E4: ; I? < F4: ; I G4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I# : ;$ : ;I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F4: ; IG.: ;' @ H4: ; I? < I!J4: ; I? < K4: ;I?  L4: ; I?  M4: ; I N4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I !I!< ".? : ; ' I@ #: ; I $: ; I %4: ; I &.: ;' I@ ': ;I (4: ;I )4: ;I *.? : ;' @ +4: ; I , : ;- . U/101 112 U341 441516.: ; ' I 7: ; I84: ; I94: ; I:: ; I;.? : ;' I@ <4: ; I? < =!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' I@ $4: ; I %1&41' U( U)41 *1+1,1 -.: ; ' I .4: ; I/ 0: ; I1: ; I2.: ; ' 34: ; I44: ; I 5 6: ; I 7 8: ; I 9.? : ; ' @ :4: ; I? < ;4: ; I?  4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I 34: ;I4.: ;' @ 5: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH4: ; II J.: ;' I K : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $1%1 &.: ; ' I ': ; I(: ; I).? : ; ' @ *1+.: ; ' ,1-4: ; I? < .!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I"< #.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; !I!< ".? : ;' @ #: ;I $.? : ; ' @ %: ; I &4: ; I '4: ; I (1)1*1 + , U-4: ; I. /.: ; ' I 0: ; I1.? : ; I@ 2.? : ; ' I@ 314 U541 6.: ;' I 7: ;I84: ;I9: ; I:: ;I ;4: ;I <.: ; ' =4: ;I >.? : ;' I@ ? : ;@4: ;IA.: ;' B4: ; I? < C!D4: ; I? < E4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; @ # $4: ; I% &.? : ; ' @ ': ; I (: ; I )4: ; I *4: ; I +4: ; I? < ,!-4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $4: ; I %4: ; I&.? : ; @ ' : ; ( U)4: ; I *.? : ; ' @ +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? < ? G src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdio.hstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hPdd9T9,V  99,VV9,Vj:Ve%9^a;dKY#lq [a9+V0co>rzq< +w 9(WVVVVVUrGr<:t=_g'Yf՜Wu,8VdFGsuOf39M939M{79I979Ig-9exU59K959KsƠȎWr ՠIrdVH,Kȏ.d-)-WT ȂSTG9&DIzs~GI&d8H~c@999H cU"G2yG~c~+~9 +w qw9~c~+~9@c~+~99~qVe9+~UVUVT,RUU wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWrVddVWƸʳ~Ņƺ7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae9U:V✀v-7;zGJ8dd,d+r<7e5=|-8Vz9W=sW)-b Ȏx9.xqn=5=+nU  ;%urrVg ׀8Hdh  8rr0˸V-rsU s csU+rd5 (V8:VXYXWW~ V^<d32R<RYU9U#rqq4c~9vqUU gVkU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.hHTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.h GHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.hUd8,J:,1|8,YJJ:1n8,fŏ)g H cz91|,j8,G )g H cz91|,j8,Gfe8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8, src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h;|t*:V*,:eU,I;,qs{>>V: fsU *rey2GdT԰GYԸV< 9 R,dW:W;G;*s,5/G<*t,z91%"Lz9>:d8,J&rG f6dqJ>:V8, s+ UtqIH"Gi# f6,6-nJmqU:*J:8dede9 9W/FtGw;7eu+WHsl?n=Gj+9qԫ,rymcrI UdeHsff:8,:t +}G*:5rUc/4 9t+0VrhvU qFd*: Ժ /:uU,8I,cV qw3W<ude }+}+:~+9~9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg*h:*IH,l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.h@d8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӑ5gd;6d*GnX<;)-a;,HVVW,t #z+fm;)-a;,HVVW,rc%#z+<`>jXr;)-a;,HVVW,t oc:8HY5hdnf%V;,sHzU c, ye,H srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hglobal.htime.h=uŪ~|<:;juŪ~<,;iG R<:;XRh@XRh9 tq9c">T:;)Wcgm:drwJ,S,Wuc0dpH Tf#~9T(\x9#W2--Ӡ:Rt:s;a;H`I%;hAUdU 7WU v<8:j"OG1cO6dbdq09bS srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.hPG GfU9aG@y+@ GVeu%GdS;Td;tr*d,fwqqQ=8-^G.$+hUzG?|G+(Gc+~U=zG9qxqzG?G|9e99sY*GVQqbqdTdV,Wed8++\ 9~=zG9qxqz?G|98f99/cW7Q/9WrԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+"od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:ml srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cport_range.hfd.hport_range.hstdint.hstddef.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h0%:ydH;Hrq:8d:W U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h@%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV z src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,(O src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hport_range.hstat.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hcfgparse.hgrp.hacl.hstat.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@U~&~ U~9~~U}9 &~eV8r]*+IV8rY+2V~v4+~H~U d~~~9K6 +yUb:pdT8,p:*f GGKd:> w9v q9B &,;qH|U+8,H)Ԝ=8V 8, 8d8,)W9j8v8,8dq09Q9ddw69K9dd`8,;)V81B+ԎpGmsude8#dR:V::::z9U%xU}ƚI: r yBb-oUp9ey9dy9dy9dycy9dy9jyUdy9c5df6f Ԁ,Zd{G*:0ո8d&<,,'⪪7Ԫr6ddfz9ddj:: fK8$)s){)dk&K7) >)~UAKd8,Tdr3R9.Tg\T:bea;7ecI~,8-8~9H1t8dgGH~,ƸƝ:TV!9ycyc9c\V)8~-8I8csd8Zs8js8*<K6 +zUb:pW:Rep:*:H8dbdW7jG'GA'.8$PJ80Gb9l9cg&&f Hsvs8*r8qs8GGG GKTIT %;7:Hgs8 t8.8G99U = *d:8:8:bd"-8dVb Ua;);-l*-);l+-Qc~Yc@9Bq :e>g_=5g"c*d8x83#8mَ8j8Hd/Վ8Q:8:b:u%e8#V8d cw9:o9s8n@@@[Qoc̀Վ8*8xd8lՎ8$8U*8x8*8x8-d8dr8rirIst8x}-d8uՎ8E,d8pId8r6dd8dI'8,Hks8I'b,iHks8I'b,iHks8I'b,iHks8I'b,iHks8I',s8b,i&js8tV8xHd8)I'ds8I',s8vs8 b,i&W8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8H'Mls8 Hd8yr8 %,t8&b,i&W8~V8I'8,&W8hs8I'b,i&W8hs8I',s8b,i&W8gs8o8xH83I'b,i&W8hs8Vd8xH8I'b,i&W8hs8Vd8xH8H'Mms8 Hd8yr8 =&ggcgU9*,X~ ~Vd8GpG=z9rvs*8,uHd8$vde8ze8 8&8,gdbfR8g8dd8hru9H8!g@9c* -d:bdu&TTd8P*q+qc8s&:,d68cLd#-9*V--~c8,pcId8,cI[t8d&:,8dx@99wcwc9c;8dIqI8-?Վ8V88:w9w996:bl9d8-?Վ8b:w@99w996:bm9Ԏ8s88~'~,8dx9wc;cr8d,88v q8~Id8E,t8 }9dj Ꮀd&}c'8u8uՎ8s88tHd8},d8H,8'q+qc *q+qcHd8tH8 7rvq,d8GH,d8 s86tV8~V8xHd8 V8xHd8R8xHd8eHd8zHd8tV88xH8~b,1&u,d8 8uH,d8dVW8,8MMIK> ֎8%,d8J7-.VĂdTb:uuF,d8^$,8,8s8vHd8vp:* 06S8~$e7`e b;+L'IIZN&bpdVd,,d G1 9w9dtn0t+9I '~q6t?(|9{cUrHV{R{Ӝ'UN+4GL+6G::8u*`Ry:p.& qwU b $,&zcoUqpqU9rrq:ry9;}x9GoUm+mc~98,V+x93y+o99yU ~ srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includequeue.cqueue.htime.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hfd.hport_range.hqueue.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.h&cJW@#re)Jj9d8V,9::8H<DUQ/+Qc uc +,d8:~G8,z* G:f:b;af ndVǢHs ,:r}c*G}G,N+4GL+6GGRHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d   srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.hstandard.htime.hsession.h9:iEas,Sd=cc~'$#sv, G~9,~qUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zU<D%Vq 9t+ cK~HM1>@yq2~+( )#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`Gm+n+q{:|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcxqO92+N+4+L+1xN+6Gc9~z|Yh zc|Yh,pxr X+~=qyqyqLcrzqzqƜ x>9B9nf99c8V1c7sO197e:}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd h0 srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hglobal.htask.hselect.hG",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6:7/JU,k}qr:T:ckDGI7-v::8e :rt:/V8:a:[r8k>rV%+8d}I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎`H8,gvq 98:v9e 9vUd Jr$+:b:;7:,iwUA+T:8:'Xb:8,d$ ~$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^"Gy+ %z_S9-9S+-9!9^!9^!+^U!+^9!9^c!+^q*r!Vi8rV8:H:8dqUA+l 4'4dpUdjmUY*Gcooco95c,6rsԀd Ŏ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrkmY*G~c+~++vGE +c7-UmqRd_ c_U q_9 G_9 9H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrilvq qm?z9hUhqFq:9q9 V;%;8pHZ,@y+@y9@⎸d :pyH=53x9<Tld28,.78;+ wU5=g*Z}s 9s9: qV;V:jy9@⎸dd8y+d8 UVd[<6/540l=d:8eaX++t+;7db 9t+ 9'xq 9z9ccc?c9c+9cqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5cDcd;f6VH>9;7diV87# 4 #5/< y9 9y9j}rlTdu+ quU|8:V8}~%ɀl#i9l91q:8:r#Ŏal&iz91q:8:rHKl$?9l9wq:8:rVH/l:8:rOl&9l9U:pժ l7(#j,qb,Ď9k+cI"d:7drj s9 9t9 9V<Ӝ=':pg4h(9 #_ yG r9 UdH;ѝ9U6չ+=6< =5=_; cwG p9UdHdb:r pccq bqd qcHdedƽb:Vd pccq bqd qcddedƹ  :!9"-'pŜU@y9jn<<6mrssH9Uqn:*dvG} +9n+9n+W}c{G$;:6rrV|/r:db*:b-E;7-T dcK8bea-)d:ƀ pccq bqd qc R DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W9dV\c$_qPU s$ srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hport_range.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hstandard.htime.hglobal.hproto_http.htask.hxPAh cv9 dft**sHFcd~e9dcn[*ddl++xU~?z9.ԜhG:IGHdHw rtc + :8,H:8 9w+dp@(deU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95V;96;ԀddH40P G;ǙfrrdpVpy92fq'Er8;U=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f{GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:Z9&9H8,8:^>:8:Up9t ;I7; 9 +t9 +w,V:=C/:0,=5)$ӎ*=8z9*J`t%+`,W-+RFrJvGdr)+ VH:T1:*rt:8: 50Sq:qtf-rs:<6<`VdƸ6fKdQ!i x]:rsv9 +uqJsgV|W2rsl9+kqK8cuG cfVu)LwUcrs 5/lJ8V1rs 5/lJ8V1rs 5/lJ8Vrs 5/lJ8Vrs 5/lJ8V rsq9+pqJsd*J;H.8VRd p srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.htask.hp+?Ac+?9Y9*GCc,'XY9:rs G;q<7snssdyU<7snssdAUT Gq:Y<7snssdUU++:*dvGE++9uGR  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.htime.hpipe.hsession.hcfgparse.h ;STd8d"؎8Fe/Sc+V98&U`95 ,=\92~=pcU!8,aUGG~d9~,v2c/S9-9U5x+j`% Ud m@7zq:9{U@++o+[| $#zc 'SgWBd*ho,8[?W 9%'d* v+u;d8J<:pg5=,;(7-*K}FY,8E 9F#-K T̎*#U&F L IG *$*J&i~:pl/3A;d*?:c 9RL,b9N }<G}q~G~w~zqlis#/dK|\}'g;sdȓEe*|cq|*-z9?H(=>4h +*ed : q:*~}9}-9|9}}ӒlishّԀ"*izd Gzd G+Uqg*f+9GHR:6<~nsxw +~cV '$ 8'$ 0 3v' U#'>8zwwzzwzzP=<Gw =<Pe7bd~:b,+s&67e,Ɯ:Vu9 9u9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dw vc +O>g= m <9,+ 9krI+v9 qd $ srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h fd.h port_range.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hstandard.htime.hglobal.h task.hcfgparse.h)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#9,~qUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~+9~9+~+  9D}]u!GN4vpI:p 7-TIT  *7b<H?|&8:8&:RUq&|b,9UU|q8:8F:|8:8:8'|:,|9:*9d0(:p-V q=,::7VV Ursf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzc|Yhx|Yh,p{rdT:Vrsb~~q9z%Wur +e6} qxu{qJy=:LGrycr} 9HEƎdŹ?:?zwGG~rbdrds{3ke}dԀdd+|dqY*GdUY*GhY*G_:qY*GdUY*GhY*jż  +<dyƨ_cf)w>9B9 n f99b 8V1c7s O197e:{HH~H~VeV~zx?wq6qq6#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.h`&9::8:-J:8:-JG;#HII7;HI<b+:x usU 9T,T,+d8)),zc1sOXZPYMG f *[crH8:+(BrrP>8dtXX RGx*srb:ddS-  `.Wgrtrrrrrrrrr srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd:GH-, GdwɜQ 9vJZerUy+ru;xc^0rƎsz Uy+ srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hstandard.h;9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.h@1cU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.h2yqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.hP7!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.hpoll.h7)9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud +8:)WWS;|;);-l9_:Tif9i9 8,*z9P>TfEt6XJX R Gz*srT:ddS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.h<!G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;HrtzU?HXr q~G,as@drrc?lqp~fG~q *G ńP>pdWJ6XX8VJ8YRGu*s[,GHW⸸dzk9.*IV 9,e `.*Krtrrrrsrrr srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hDG,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9;)H-U,TV  ;7W)7W=7+՜|4f9 vc: qTV*R<(bbc"~;;S/ 7W,}9c}cGVl$VV$p:T}f9}9 T9`qqq>ae6XJ8YRGfGr,fq!rT:dǸd39.*IV 9,e `.*Krtrrrrsrrr. /var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/bitslibgcc2.clibgcc2.hstdio.hlibio.htypes.h}7:;.IKqU~q,lUH qS~r՜UqW)-7;T;V8,-I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8.$ .~  f.). <.e. E..2.. !.&.x..x.. %.-. 5.5. .|. $.. 2.. a.. n.W. .u. G.8. .. %.. .`. T.w. T.w. .. .. .k. ).D. 1.V. .. .P. e.. .. !.. /.(. /.g. @.6. q.. Z.. 6.@. .X. /.. m.q. .%. +.. +.. +.. +.. +.. <.Q. @.X. <.. +.. +.. +.. +.. +.. C... .. +.. +.. <.j. +.E. +.A. C.. 2.0..A... B.\. [.\. .<.  .D. .. f.\. 2.]. 4.z. O.. ".. .. /.6. .. k.T. M.6. '.. 7.. E.. ..1. ..n. 1.0pb  '.<  .3 . A. Д | : 0R | 4$ j !.8. 0$  8.4$  7.`$  E..D. Q.0.V.N.  .X$ 6 ..D. \.3.S.,. X$ L ..D. \.?.6.  .T$ p- ..D. \.'.6. L$  @... .[.<$ h ^. -..$ 0v   .J.=.g.n.J..^... .l.\. .{.j.p. x.. 8$ T g..| (# $#(  .#} 8#` .:.8#P_  ..,# .| 8$` . ".t$  .?. }.. .l. ..0#..C. $J $S ,$P| ?.,${ ?.$P $$p .| &7 &* T& .... @.. .D&Y a.Y. .B. T&` <.5.... .0&@z ".l&5 J........+..L&  _...=..H& .%. ... ,&P .,&S .<&P [..d.|&05 .J. ...  . . ... )..t&pg  .2. ... 3.l....  .$& .| *Q p*`T  . K.........<*  ?...0*  U.0* .0*P0 =.0*` U.$* .| 4,9 ..0,@t  .0,c .0,0 /.(,\ 8,  ^..4,+ . . 0, .$,E (,a (, <,P  .n.3.X,. 0.....2..D, E  w.. .. 0,p .(,0 (, D, .S.:.. 8,  G.a. 0,p $ .8, . .8, R. ..0,0 .4, %. .<,` . k.. L, b. .. 8..0,  Z.X, .. .. L.. -.0,0! I.X,$t  .0. .&. .. .<,, . .. L,. [. n.. 5.3.0,`0 U.<,0 E. &.*. ,1  =.F. G.\... ].. .p. u.. g. .u. g..H. d. .M. Z.<. .+. .P,?d  ..F. ... J... S. . .@. .. .G. _./. .. ...q.X. [.4.. ".>. w.q. *..b. .._. q..e. s.x.&. .<,Y\  ..&.,pYD ,,Yo =.,,0ZA  .(,ZY (,ZY (,@[e ,[: ,,[s 5.,,p\v 5.0,\ *. ,,]E ;.,,]? 5.0,0^_ -. ,,^E ;.,,^? 5.8, _ *. ^.,,_E ;.,, `? 5.8,`` /. w.,,0aE ;.,,a? 5.(,ad $,0b .| (;PbC D;bA M. {. .C.,;dx I.T;pe .J. .\.1.$.,;0l 8.8;l ..0;o 1.$;pqj '.0;qW .| $=@t .<=u) %..P.0=@vJ .$=w& .$=wM ,=x .| (>x  >y >zA (>zr (>P{n <>{b ...0>0}A $.0>~ x.0>P u.(> (>" L>Ђ  . .{.'.r.,>`c %.,>Ѕ .4> . .D> $. .B.0.,> .8>ЊF  ..<>  . 0..8>Ў W. f.|>6  2.\.U.E.t.l.%.+..<.;.0.,>0t O.,> c.>@   .{. .. 1..&. `.. Q.. O...0>D <.>P; 0> .0> 5.0>0 5.0> 5.0> 5.0> y 5.0>y 5.0> y 5.0> 5.$>P .| Fp- F* ,Fб .,Fp .| 0XG   R.$XG .XXGb  .. .v. .4.0#.. ... . ..@ ..0.X. ..pF. b.=.0./. .-. `.....l. #..0#..@4. L.7.p...TXGp .. ..pd. .<XGY 5..` .,XGp9 .XG . '.\. '.T. Z.p. D.!. -. .;. B.?. #.. D.XXG   .). s..0+..@.$XG .| <K f. .S. LKP O.F. v.!.. 0KpT .KQ K0Q 0K\ m. tKx .\. .. b.Q. ;.X. ..0..Kp+ (K $K6 .| ,LM{ _.8LM@ ..$LM? #.(LM 0LMC .0LMP/  .0LM }.LLM .6.t..t.LM@o LM ....$.I.4..8._.F..2.. .R. .H. .$LMPp | (P | DP`$ DP  DP  $DP5 $DP0 DP@$ 8DPp . .,DP .,DPL  .DP0  DP@ | $RC .,R  %.4Rt 5...0R@  .| R R0 R0 RP  R`  Rp ,Rc ,.4R *. +.,RX !.,Re &.0R [.0R@\ .$R .$R .(Rm RP) 0R=  .$R  .,Rd  .(R@4 (R. $R"+ .R" R# 0R #@ .0R`# .,R$L .0R`$a <.<R$ .X..<R&c ./. .<R&  .. .<R( !.. .0R )h +.0R) .8R@+ . .(R,; $R - .| 0Y0- M.,Y- Z.8Y.\ .#. .,Y.4 .,Y /Q  .<Y/ .R.0D. | (Z@0O (Z0F $Z0S | (t[@1 (t[2 | 0[2_ .0[4n .([p5{ ([5 ([6 | 8\P7 .1. .| 0]7$ 0]8  0] 8  $0]@85 $0]80 0]8$ 00]8R .,0]@; ".,0];@  .0]0<  0]@< | $^<' ^=" (^0= ,^ >? (^`>U (^>X (^ ?N (^p?K 0^? x.,^A- H.,^B .$^pC( .,^C2 ..^C | $\aD' ,\aDJ ,\aEP \a`E2 (\aEt (\a Fc ,\aF .$\aF D\aF ..T.X.,\a`L  K.,\apM  .$\aM( .,\a N2 ..\a`N | (c | ((d  totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavailsrc/haproxy.c__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconnlocal_portre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_add/data/git/public/haproxy-1.3cookie_strprev_ctrhash_listfailed_secualgo__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnputcharbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlenerr_codewmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbconn_retriesnext_svidgracepool2_requrinow_msnbbeuri_len_limitportsnode_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addsport_rangefbckhh_lentv_acceptHTTP_METH_HEADto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopnb_tasksfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyfastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tcfg_nbcfgfileslogsdo_logsrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headuri_dirs_depth1l_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lencallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognamedowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authnode_copystats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_namestats_set_nodeout_realmstats_add_scopestats_set_realmstats_check_init_uri_auth__lendesc_copyout_base64ulistnew_nameout_ubase64stats_set_descsrc/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sunout_nofree__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstr2sa_rangestrl2llrcret_valomultidivstr2saporthportloctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrnbloggerssend_logsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitylogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifsetmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date__tv_isgt_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollerport_range_release_portnbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_init__reschain_regexhex2regmatch_tsrc/regex.chex1rm_eocheck_replace_stringregoff_trm_soexp_replacepmatchold_dstmatcheswarnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listport_lowproxy_type_strst_sizeatoist_blksizepw_passwdcurproxyconfsectst_gidproxy_reset_timeoutscfg_keywordnext_pxid__s1check_config_validitynext_srvport_highwarnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalinit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkport_range_alloc_rangepw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bckset_server_uptick_addout_errortask_newprocess_chkfd_insertpc_endevent_srv_chk_rpendconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledsrv_was_pausedbind_attemptsout_wakeupstart_checksport_range_alloc_portcheck_for_pendingout_nowakeset_server_enabledredistribute_pendingset_server_downmininterevent_srv_chk_wlskerrsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrv_dynamic_maxconnpendconn_addsrc/queue.cpendconn_get_next_sesspendconn_freependconn_from_srvinit_pendconnprocess_srv_queueratioget_frt_addripv4out_fail_idxacl_fetch_dstacl_fetch_dportout_free_sessionladdracl_testsalensrc/client.cmax_setpatternsacl_keywordmin_setfreeptrbufupdate_freq_ctrout_fail_reqcapfetchout_closebuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskout_fail_rspcapacl_fetch_dconnmax_acceptacl_fetch_sportout_fail_repout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrmaintain_proxiesproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosetick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsunix_sock_usagedestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_requnix_sock_usage_msgcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxhttp_msg_oodhttp_msg_rpbefore_crdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdracl_fetch_shdr_ipbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookiepathlenquotedhttp_msg_rpline_eolacl_fetch_chdr_ipacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverasession_temphttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenret_ptrhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptracl_fetch_hdr_iphttp_is_tokenauthenticatedhttp_find_header2local_asessionhttp_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirectnext_responsehttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcodenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrhttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupappsession_refreshinitializedhtblelementkey1ses_msizeidlenappsession_initkey2appsess_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_erracl_fetch_queue_sizeprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queueacl_fetch_avg_queue_sizemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serveracl_fetch_be_connsrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdacl_fetch_fe_connbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serversbuffer_abortsrc/stream_interface.cstream_int_returnstream_int_check_timeoutsstream_int_retnclosestream_int_report_errorsection_typesv_statesrc/dumpstats.cultoaprint_csv_headercurpxsrv_hlt_ststats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafterfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwenddefault_acl_listout_free_expracl_match_domacl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_stracl_match_subtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01BTj w , 6  % y \ M h 8u\ d HY #RU^cX[CT^6`r^o ,}pPSYx1;Oc?I9CQeFPcjEcj C*0yq s Ni$,68BG^4vAFchQY^h T }nq@C    X |   7bqCn@ #0!&0:ks!" !  !!$ ||I$p$$&$Q""||$$t%#&$W%$$',(4(((}*D+,*+,.//>./ ;;/k:=/u/x//N1t2-775b6o1v1|112378b6-722224G5J5U5899#9#9_9b9m9GABIQZ9BCQZZAIIBCAII4DDG@GLF GDLF@GAIKLYY9MsM"M9MVUW1VnVPQR S)QR/TRUSS SSQQ SZSQQQQQQUUWWU1VtXXWWWtX3YYYYY>YYYYYZ[\7zgz[[[\\\\\}]N]]]m^u^^^]_`ae___`kk``1aa#^։ab!NcccBdWddeee?fGfffggh#hhhRijkՋ͋kl^lmFoonFotustXuv t+t1t6t%uXuvvvy߈*gz{p8|}||~|jލsb)9unFה2ؖ2 ҕ|f ?D`?X˛ţSXl Dl D6ADF eflE  " @  =&hxb0C00Cfy  ' U +)n)@n)@' b @ e@S#)SiFYAC 7  7J9 ? M ` E G iJ[qv~y~  0&%? _ Z f R T E Q o    S Y J119>Ts{Nf#qv6u "  `!!!!!!!!z!!!!!!!!#$8$%J+d+r++,Z,,02-.20211:11+00--:1M1--Z.u.M1`1/0110+0//11//U0p011224-43344I4d44 5w555=55=77<<=7C7<<F7[7`8f8<<i8~88\9p<<998;;:8;=C=;e<;;<<;C<F<e<AAAACBHBSBYBLBNBBFKP(FKCFG>GnFGDEnFGHHHHHHIEJOZOQARggg7g ffdd a/a_`0]^Z[Z.ZRXQQQV=W^\0]ij?iigh\0]ijgh]^ ff a/a^^ ffO__7gKg` a@eSebXchi#cTchiXcscggcdfEfd@eEf_f?iiiiqqqr^2 _- h  RfM O S p t v []aw2HLNWF nNp , 5F P+7>P*6$%X,,+F+@*+ **()T)&',,F+V+++(()''''<,X,T) *E0S0e11E0S0e11[0e1z33Q3`3/3<3j233333%'/"[}SV=P %+ik}SVCP _ =!#.B l 1T .8P.88BP8BP!#%&%%#f%6&E&K&M&&'0+K-'*(),,'**)*((,,'**7()+(1("(%(((0+,,K- 04<@t l    9 # 2;>@kps{ 7 = ]  q | ? D  8 j =EZQ7&:7I,4t9S0369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_'*xz{pAI70Dqw`a=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh07 ?(( `GoTo\\@c 8l ԏ u%pԒ{%$$>@@> \\ ttt<x| |h | =Qe@&7]5y m- -9 hdF0,i IQ W % ep 8'v  /4Hh(\ԏ  Ԓ  $ @\t !"#$%&' (/Ę >I/Ę Ę t   !.p<H >^/$ (p5 (X2=HnMpRWag s$(̤ĤФؤ 2 0  &1 > lDGR[dj u    6  L p-  h  8S *J 8P| F{ VP fp t|Ԗ Y  @T`T   'Y\ 6pYD EYo T0ZA bZY rZY @[e [: [s p\v ]E ^E _E 0aE ]? ^? . `? Aa? Sad bp a  \ 0^_  _ `` 0b bA &3CQ_i y0    y y  y  y zA 3zr NP{n g0}A ~ " Ђ  `c Ѕ     7 P F Y |e  x     p+  |0 x `T pT  T / 6 C M W c `$ o w     5 0 @$ p   L 0  @     0  0 % 2 @\ =   J $L W `$a f - q z        c 7$ o w 8  8  @85 80 8$ 8R @; ;@ 0<  @<      <' c =" o  0=    % >? w `>U >X ?N 4 p?K ? =  A- B pC( J C2 C S _ g q x   D' DJ EP c `E2 w Et Fc F 4 F   F  =    `L  pM M( J N2 `N    O O   O" , P" B 4P< R pPk f Q m /Q y g~ hH /T `j j8 k k  s T/ ,W| W LX *X> ;Z\ HxZ@ UZ k[F z[O @\] \\ \2 0]0 `] (yt { || D} / $,4v >d! D/ S/ _/ m/ F / = {b  `C ^ #P; /c Epf Mch^P j |Kx  *  `(Ў (~ "` '0 1d <hH5 Y2 _h H@ . @t ; #@ dQ1 @ # .P =O X( i )h x1  .\ YP; 7 t   x  :2 H Op VwM ^ t/6    P  p- t &5 4P7 KV f@S ru) =HP0 T 0v  @ 8 0  "6 (79 IO- \@ s@zM 2_   4Q/ @^//@ N 0l 2D`3 M V` dvY б ' v D7@   2 0 ;( IPp [  t0F  I pw 1@K Д PbC @+ 'O  3 @f Ht X  h@z s  |` 0 p p @   # O 8J  TX b o@( wC ` x dx e :I  ;@vJ @+ &  8:LP ]Tj@4 xZ p3 1 l :k 0S ` P  5(0U 8Jз= Z0R g/y   P_ P1 ? pb 7P &`P 0C Gм Vi:{   & w& P ;0Q # c !@o 5E C:Yp: lpZ z   0: " : ` 3) /:BN\ ahm |~   .  7$ 0" Aн { 6 E S Zm h/ q- z87 PC . 7O   0t * `  < p I V h 0) p ~ Pz ` 6  Q P/     = !.4 !5 #!@*! $0- J$W a$HS i$. ~$,$p9 $A $` $ $S $ $P %d %S %5% @%N%$t i%Q y%3%  %:%@  %8%$ %#%@ %q & !&0& =&#F&cX&:o&&T&`% & X&X&Q &@t &p5{ &0 &;&P&h 'b''3;' I'`'=p'0 ''p ': ''P' ''' /Q '^(P  (S"(4n /( =(`0 W(c(pu((( E ((+ (\ (b (p ( ) C )} )Q,)@' 4) ;)Pp H)P) U)|\)) k)))t)% ):) )1  ) )&c ) I * *h+*D B*W*Aa*ux*pqj *:**qW *05 **Q *pA ++ +t&+l0+  <;+D+W+ЊF e+`8 n+5 +@ +x+= +++0! +% +, ,Y +,`#:,7 S,Db,/ m,@0O {,`# ,;,` ,F ," ,# ,  ,` -   -D'-  6-:F-R N-/a-s- -pg -0 -` P--pe --:- -?d .  .+.@e<4.@.0 J.Y.` f.3 n.@.Ф .P  .P . .* .p9 . .=.. /3 /Ж!/\ 0/g H/ X/P j/ }/p $ /o /H/ /7/ abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidscfg_nbcfgfilescfg_cfgfileoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.2sa.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerdefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_chdr_ipacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_shdr_ipacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_valacl_fetch_hdr_ip__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_rateacl_fetch_fe_connacl_fetch_be_connacl_fetch_queue_sizeacl_fetch_avg_queue_sizerecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registersignal.cacl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsrecurse.0freq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleunix_sock_usageenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allwarnif_misplaced_reqaddbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzersigfillset@@GLIBC_2.0recalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0get_server_hhpcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1signal_queuehttp_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condwarnif_rule_after_redirectactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startwarnif_rule_after_reqxxxpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroyinit_default_instancegetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo__signal_process_queue_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlineeb32_inserthttp_capture_bad_messagetcp_splice_initfdtrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0signal_queue_lenchunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icsignal_registerbuffer_replace2findserverhostnamesess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaysignal_statedisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuewarnif_rule_after_blocknb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0tcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0stderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_mallocstats_set_desccfg_parse_listencheck_config_validitywaitpid@@GLIBC_2.0acl_match_dirunix_sock_usage_msgparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301warnif_misplaced_blockpool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0str2sa_rangea2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopsignal_initinit_proto_httphttp_200_chunksigprocmask@@GLIBC_2.0strncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requirestats_set_noderegcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_tokenwarnif_rule_after_use_backend__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeroblocked_sigpollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onewarnif_misplaced_reqxxxsrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_IO_putc@@GLIBC_2.0_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warningmy_strnduphttp_err_codeswarnif_rule_after_reqadd_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2signal_handlerrecv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingurl2ippcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info